IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ han-2015-1 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps tag fluorescence tag visualisation by fluorescence tag fluorescence Han B., Park D., Li R., Xie M., Owonikoko TK., Zhang G., Sica GL., Ding C., Zhou J., Magis AT., Chen ZG., Shin DM., Ramalingam SS., Khuri FR., Curran WJ., Deng X. Cancer - Interactions investigated in the context of cancer Competition Binding Assay:fluorescent peptide tracer and a nonfluorescent small-molecule inhibitor compete for binding to the target protein (Bcl-2). When the reaction mixture contains a small-molecule inhibitor, the tracer is displaced by the small-molecule inhibitor from the target protein and the emission signal becomes depolarized. The Bcl-XL interaction with the BAD peptide cannot be annotated as the Bcl-XL protein cannot be found on the stated suppliers web page (NeoBioSci). Similarly the Bfl-1/A1 interaction cannot be added as the origin of BFL-1 is ambiguous. xdeng4@emory.edu Cancer cell 2015 Only protein-protein interactions imex curation imex curation han-2015-2 in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight by bromide molecular weight estimation by bromide staining weight by bromide Han B., Park D., Li R., Xie M., Owonikoko TK., Zhang G., Sica GL., Ding C., Zhou J., Magis AT., Chen ZG., Shin DM., Ramalingam SS., Khuri FR., Curran WJ., Deng X. Cancer - Interactions investigated in the context of cancer After incubation of reactants, 4 ul loading dye was added to a the sample, and electrophoresis was performed. Gels were stained with ethidium bromide solution, illuminated with UV light, and photographed. xdeng4@emory.edu Cancer cell 2015 Only protein-protein interactions imex curation imex curation han-2015-3 human-h460 Homo sapiens non-small-cell lung cancer cell line H460 h460 human non-small-cell lung cancer cell line H460 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Han B., Park D., Li R., Xie M., Owonikoko TK., Zhang G., Sica GL., Ding C., Zhou J., Magis AT., Chen ZG., Shin DM., Ramalingam SS., Khuri FR., Curran WJ., Deng X. Cancer - Interactions investigated in the context of cancer Results from Supplementarty figure 3D cannot be included as the antibody target "IP3R" could be one or more molecules. xdeng4@emory.edu Cancer cell 2015 Only protein-protein interactions imex curation imex curation han-2015-4 human-h460 Homo sapiens non-small-cell lung cancer cell line H460 h460 human non-small-cell lung cancer cell line H460 fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Han B., Park D., Li R., Xie M., Owonikoko TK., Zhang G., Sica GL., Ding C., Zhou J., Magis AT., Chen ZG., Shin DM., Ramalingam SS., Khuri FR., Curran WJ., Deng X. Cancer - Interactions investigated in the context of cancer Nu/Nu mice with NSCLC - H460 cell line xenografts. xdeng4@emory.edu Cancer cell 2015 Only protein-protein interactions imex curation imex curation bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS bda-366 BDA-366 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) q07820-1 Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-like protein 3 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1L MCL1 BCL2L3 MCL-1L protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR mint cisplatin cisplatin [PtCl2(NH3)2] Briplatin CDDP cis-[PtCl2(NH3)2] cis-DDP cis-diamminedichloroplatinum cis-Diamminedichloroplatinum(II) cis-diammineplatinum(II) dichloride cis-dichlorodiammineplatinum(II) cis-platin Cismaplat Cisplatin cisplatin cisplatine cisplatino cisplatinum Lederplatin Neoplatin Peyrone's chloride Peyrone's salt Platamine Platinex Platinol Randa (SP-4-2)-diamminedichloridoplatinum (SP-4-2)-diamminedichloroplatinum cis-diamminedichloridoplatinum(II) cis-diamminedichloroplatinum(II) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) puc19c pUC19c dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid synthetic construct synthetic construct b2l11_human Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG bak1-bcl2-2 1810710 N/A 1810714 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) N/A 1810715 unspecified role unspecified role neutral component neutral component N/A sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false Supp 1Ai Both the Wt and the BH4 deletion mutant appeared to bind to Bcl2 in the absence of BDA-366. bak1-bcl2-1 1810710 N/A 1810716 competitor competitor competitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 1810710 N/A 1810714 unspecified role unspecified role neutral component neutral component N/A required to bind necessary binding region required to bind range range range range false ecoli Escherichia coli (strain K12) 1810710 N/A 1810715 unspecified role unspecified role neutral component neutral component N/A sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false Supp 1A/B The BH4 deletion mutant did not bind BDA-366 . BDA-366 directly binds to WT Bcl2 with high binding affinity (Ki = 3.3nM). Using a compound Bcl2 mutant D10A/N11A/R12A/E13A (AAAA) a Ki value of ~600nM was obtained, showing decreased BDA-366 binding. (results not shown). bcl2-bda_366-1 1810710 N/A 1810716 competitor competitor competitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 1810710 N/A 1810714 unspecified role unspecified role neutral component neutral component N/A required to bind necessary binding region required to bind range range range range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1810710 Supp 1Aiii bak1-bcl2-3 1810710 N/A 1810717 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1810715 unspecified role unspecified role neutral component neutral component N/A sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) 1810743 1810741 direct interaction direct interaction false false false Supp 1B 56yery-1 1810711 N/A 1810718 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1810719 unspecified role unspecified role neutral component neutral component synthetic construct synthetic construct direct interaction direct interaction false false false Supp 1K BDA-366 did not bind DNA 35a6twetr-1 1810712 N/A 1810720 unspecified role unspecified role prey prey N/A 1810721 unspecified role unspecified role prey prey N/A 1810714 unspecified role unspecified role bait bait association association false false false 2G BDA-366 enhanced the Bcl2/Bax interaction in association with decreased Bcl2/Bim binding. 2435w4t-1 1810713 N/A 1810714 unspecified role unspecified role neutral component neutral component N/A 1810721 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 6, Supp 5. BDA-366