IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ xu-2015-12 in vitro In vitro pull down pull down sequence tag sequence tag identification sequence tag Xu SQ., Buraschi S., Morcavallo A., Genua M., Shirao T., Peiper SC., Gomella LG., Birbe R., Belfiore A., Iozzo RV., Morrione A., Xu SQ., Buraschi S., Morcavallo A., Genua M., Shirao T., Peiper SC., Gomella LG., Birbe R., Belfiore A., Iozzo RV., Morrione A. Cancer - Interactions investigated in the context of cancer Recombinant Progranulin was determined to be of Human origin - as used in previous work of the last author A. Morrione;References 10 (6His-tagged human proepithelin-ref 7, expressed in 293 cells), references 8 (expressed in 293 cells)and 11,pmid:16849556. Andrea.Morrione@jefferson.edu,renato.iozzo@jefferson.edu Oncotarget 2015 Only protein-protein interactions imex curation imex curation Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. xu-2015-14 human-5637 Homo sapiens 5637 5637 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Xu SQ., Buraschi S., Morcavallo A., Genua M., Shirao T., Peiper SC., Gomella LG., Birbe R., Belfiore A., Iozzo RV., Morrione A., Xu SQ., Buraschi S., Morcavallo A., Genua M., Shirao T., Peiper SC., Gomella LG., Birbe R., Belfiore A., Iozzo RV., Morrione A. Cancer - Interactions investigated in the context of cancer Recombinant Progranulin was determined to be of Human origin - as used in previous work of the last author A. Morrione;References 10 (6His-tagged human proepithelin-ref 7, expressed in 293 cells), references 8 (expressed in 293 cells)and 11,pmid:16849556. Andrea.Morrione@jefferson.edu,renato.iozzo@jefferson.edu Oncotarget 2015 Only protein-protein interactions imex curation imex curation Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. xu-2015-15 human-5637 Homo sapiens 5637 5637 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Xu SQ., Buraschi S., Morcavallo A., Genua M., Shirao T., Peiper SC., Gomella LG., Birbe R., Belfiore A., Iozzo RV., Morrione A., Xu SQ., Buraschi S., Morcavallo A., Genua M., Shirao T., Peiper SC., Gomella LG., Birbe R., Belfiore A., Iozzo RV., Morrione A. Cancer - Interactions investigated in the context of cancer Recombinant Progranulin was determined to be of Human origin - as used in previous work of the last author A. Morrione;References 10 (6His-tagged human proepithelin-ref 7, expressed in 293 cells), references 8 (expressed in 293 cells)and 11,pmid:16849556. Andrea.Morrione@jefferson.edu,renato.iozzo@jefferson.edu Oncotarget 2015 Only protein-protein interactions imex curation imex curation Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. xu-2015-16 human-t24 Homo sapiens T24 bladder carcinoma cells t24 Human bladder carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Xu SQ., Buraschi S., Morcavallo A., Genua M., Shirao T., Peiper SC., Gomella LG., Birbe R., Belfiore A., Iozzo RV., Morrione A., Xu SQ., Buraschi S., Morcavallo A., Genua M., Shirao T., Peiper SC., Gomella LG., Birbe R., Belfiore A., Iozzo RV., Morrione A. Cancer - Interactions investigated in the context of cancer Recombinant Progranulin was determined to be of Human origin - as used in previous work of the last author A. Morrione;References 10 (6His-tagged human proepithelin-ref 7, expressed in 293 cells), references 8 (expressed in 293 cells)and 11,pmid:16849556. Andrea.Morrione@jefferson.edu,renato.iozzo@jefferson.edu Oncotarget 2015 Only protein-protein interactions imex curation imex curation Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. xu-2015-17 human-urinary_bladder_carcinoma Human urinary bladder carcinoma Human urinary_bladder_carcinoma urinary bladder carcinoma fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Xu SQ., Buraschi S., Morcavallo A., Genua M., Shirao T., Peiper SC., Gomella LG., Birbe R., Belfiore A., Iozzo RV., Morrione A., Xu SQ., Buraschi S., Morcavallo A., Genua M., Shirao T., Peiper SC., Gomella LG., Birbe R., Belfiore A., Iozzo RV., Morrione A. Cancer - Interactions investigated in the context of cancer high grade urothelial carcinoma tissue Recombinant Progranulin was determined to be of Human origin - as used in previous work of the last author A. Morrione;References 10 (6His-tagged human proepithelin-ref 7, expressed in 293 cells), references 8 (expressed in 293 cells)and 11,pmid:16849556. Andrea.Morrione@jefferson.edu,renato.iozzo@jefferson.edu Oncotarget 2015 Only protein-protein interactions imex curation imex curation Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. dreb_human Drebrin DBN1 Developmentally-regulated brain protein D0S117E protein protein human Homo sapiens Human MAGVSFSGHRLELLAAYEEVIREESAADWALYTYEDGSDDLKLAASGEGGLQELSGHFENQKVMYGFCSVKDSQAALPKYVLINWVGEDVPDARKCACASHVAKVAEFFQGVDVIVNASSVEDIDAGAIGQRLSNGLARLSSPVLHRLRLREDENAEPVGTTYQKTDAAVEMKRINREQFWEQAKKEEELRKEEERKKALDERLRFEQERMEQERQEQEERERRYREREQQIEEHRRKQQTLEAEEAKRRLKEQSIFGDHRDEEEETHMKKSESEVEEAAAIIAQRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGSHLDSHRRMAPTPIPTRSPSDSSTASTPVAEQIERALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAEDLMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWPGNGEGASTLQGEPRAPTPPSGTEVTLAEVPLLDEVAPEPLLPAGEGCATLLNFDELPEPPATFCDPEEVEGESLAAPQTPTLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQSQEEEFAQSEELCAKAPPPVFYNKPPEIDITCWDADPVPEEEEGFEGGD grn_human Progranulin Proepithelin GRN Acrogranin Epithelin precursor Glycoprotein of 88 Kda Granulin precursor PC cell-derived growth factor protein protein human Homo sapiens Human MWTLVSWVALTAGLVAGTRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL 765d8d6ur-1 2844679 N/A 2844684 unspecified role unspecified role prey prey human-5637 Homo sapiens 5637 5637 N/A 2844685 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false 1A grn-dbn1-1 2844680 N/A 2844684 unspecified role unspecified role neutral component neutral component N/A 2844685 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 1D Colocalization was observed in punctate vesicles. grn-dbn1-2 2844681 N/A 2844684 unspecified role unspecified role prey prey N/A 2844685 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false 2A grn-dbn1-3 2844682 N/A 2844684 unspecified role unspecified role prey prey N/A 2844685 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false 2B dbn1-grn-1 2844683 N/A 2844684 unspecified role unspecified role neutral component neutral component N/A 2844685 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 7L