IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ jeon-2015-3 human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jeon YJ., Khelifa S., Ratnikov B., Scott DA., Feng Y., Parisi F., Ruller C., Lau E., Kim H., Brill LM., Jiang T., Rimm DL., Cardiff RD., Mills GB., Smith JW., Osterman AL., Kluger Y., Ronai ZA. Cancer - Interactions investigated in the context of cancer V5 tagged plasmids were found on the DNASU Plasmid Repository website, The Biodesign Institute/Arizona State University. ronai@sbmri.org Cancer cell 2015 Only protein-protein interactions imex curation imex curation jeon-2015-2 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jeon YJ., Khelifa S., Ratnikov B., Scott DA., Feng Y., Parisi F., Ruller C., Lau E., Kim H., Brill LM., Jiang T., Rimm DL., Cardiff RD., Mills GB., Smith JW., Osterman AL., Kluger Y., Ronai ZA. Cancer - Interactions investigated in the context of cancer V5 tagged plasmids were found on the DNASU Plasmid Repository website, The Biodesign Institute/Arizona State University. ronai@sbmri.org Cancer cell 2015 Only protein-protein interactions imex curation imex curation jeon-2015-1 human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Jeon YJ., Khelifa S., Ratnikov B., Scott DA., Feng Y., Parisi F., Ruller C., Lau E., Kim H., Brill LM., Jiang T., Rimm DL., Cardiff RD., Mills GB., Smith JW., Osterman AL., Kluger Y., Ronai ZA. Cancer - Interactions investigated in the context of cancer ronai@sbmri.org Cancer cell 2015 Only protein-protein interactions imex curation imex curation jeon-2015-4 in vitro In vitro cleavage cleavage assay cleavage weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Jeon YJ., Khelifa S., Ratnikov B., Scott DA., Feng Y., Parisi F., Ruller C., Lau E., Kim H., Brill LM., Jiang T., Rimm DL., Cardiff RD., Mills GB., Smith JW., Osterman AL., Kluger Y., Ronai ZA. Cancer - Interactions investigated in the context of cancer Purified, radiolabelled SLC1A5-V5 underwent proteolytic cleavage by BNPS-Skatole. ronai@sbmri.org Cancer cell 2015 Only protein-protein interactions imex curation imex curation jeon-2015-5 in vitro In vitro cleavage cleavage assay cleavage anti tag western anti tag western blot anti tag western Jeon YJ., Khelifa S., Ratnikov B., Scott DA., Feng Y., Parisi F., Ruller C., Lau E., Kim H., Brill LM., Jiang T., Rimm DL., Cardiff RD., Mills GB., Smith JW., Osterman AL., Kluger Y., Ronai ZA. Cancer - Interactions investigated in the context of cancer Purified, radiolabelled SLC1A5-V5 underwent proteolytic cleavage by BNPS-Skatole. ronai@sbmri.org Cancer cell 2015 Only protein-protein interactions imex curation imex curation aaat_human Neutral amino acid transporter B(0) ASCT2 M7V1 RDR RDRC SLC1A5 Sodium-dependent neutral amino acid transporter type 2 RD114/simian type D retrovirus receptor Baboon M7 virus receptor Solute carrier family 1 member 5 protein protein human Homo sapiens Human MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVVAVVAGVALGLGVSGAGGALALGPERLSAFVFPGELLLRLLRMIILPLVVCSLIGGAASLDPGALGRLGAWALLFFLVTTLLASALGVGLALALQPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPSNLVSAAFRSYSTTYEERNITGTRVKVPVGQEVEGMNILGLVVFAIVFGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIVEMEDVGLLFARLGKYILCCLLGHAIHGLLVLPLIYFLFTRKNPYRFLWGIVTPLATAFGTSSSSATLPLMMKCVEENNGVAKHISRFILPIGATVNMDGAALFQCVAAVFIAQLSQQSLDFVKIITILVTATASSVGAAGIPAGGVLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESVM rnf5_human E3 ubiquitin-protein ligase RNF5 RNF5 G16 RING finger protein 5 Protein G16 NG2 RMA1 Ram1 homolog RING-type E3 ubiquitin transferase RNF5 protein protein human Homo sapiens Human MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI s38a2_human Sodium-coupled neutral amino acid transporter 2 ATA2 KIAA1382 SAT2 SNAT2 Amino acid transporter A2 System A amino acid transporter 2 System N amino acid transporter 2 System A transporter 1 Solute carrier family 38 member 2 Protein 40-9-1 SLC38A2 protein protein human Homo sapiens Human MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKKKYETEFHPGTTSFGMSVFNLSNAIVGSGILGLSYAMANTGIALFIILLTFVSIFSLYSVHLLLKTANEGGSLLYEQLGYKAFGLVGKLAASGSITMQNIGAMSSYLFIVKYELPLVIQALTNIEDKTGLWYLNGNYLVLLVSLVVILPLSLFRNLGYLGYTSGLSLLCMVFFLIVVICKKFQVPCPVEAALIINETINTTLTQPTALVPALSHNVTENDSCRPHYFIFNSQTVYAVPILIFSFVCHPAVLPIYEELKDRSRRRMMNVSKISFFAMFLMYLLAALFGYLTFYEHVESELLHTYSSILGTDILLLIVRLAVLMAVTLTVPVVIFPIRSSVTHLLCASKDFSWWRHSLITVSILAFTNLLVIFVPTIRDIFGFIGASAASMLIFILPSAFYIKLVKKEPMKSVQKIGALFFLLSGVLVMTGSMALIVLDWVHNAPGGGH bnps-skatole BNPS-Skatole small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) rnf5-slc1a5-3 1800611 N/A 1800616 unspecified role unspecified role prey prey N/A 1800617 unspecified role unspecified role bait bait physical association physical association false false false 2D/E BFA -brefeldin A (fungal antibiotic that inhibits protein transport from the endoplasmic reticulum to the Golgi apparatus inducing ER stress) Paclitaxel; a taxane, a microtubule stabilizer, halting mitosis. rnf5-slc38a2-2 1800611 N/A 1800618 unspecified role unspecified role prey prey N/A 1800617 unspecified role unspecified role bait bait physical association physical association false false false 2E Paclitaxel; a taxane, a microtubule stabilizer, halting mitosis. slc1a5-rnf5-1 1800611 N/A 1800616 unspecified role unspecified role bait bait N/A 1800617 unspecified role unspecified role prey prey physical association physical association false false false 2D-2 BFA -brefeldin A (fungal antibiotic that inhibits protein transport from the endoplasmic reticulum to the Golgi apparatus inducing ER stress) rnf5-slc1a5-2 1800612 N/A 1800616 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1800617 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false range range certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1A Binding was much weaker to the Ring-domain mutant than wild-type RNF5. rnf5-slc38a2-1 1800612 N/A 1800618 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1800617 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false range range certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1B, Supp 1B rnf5-slc1a5-1 1800613 N/A 1800618 unspecified role unspecified role prey prey N/A 1800616 unspecified role unspecified role prey prey N/A 1800617 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false range range certain certain sequence position certain false association association false false false no figure slc1a5-1 1800614 N/A 1800616 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma N/A 1800619 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) protein cleavage protein cleavage false false false 4G Paclitaxel; a taxane, a microtubule stabilizer, halting mitosis. BNPS-Skatole is a peptide cleavage reagent specific for the carboxyl side of tryptophan residues. slc1a5-2 1800615 N/A 1800616 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma N/A 1800619 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) protein cleavage protein cleavage false false false 4G Paclitaxel; a taxane, a microtubule stabilizer, halting mitosis.