IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ jin-2015-7 in vitro In vitro oxidoreduct assay oxidoreductase assay oxidoreduct assay predetermined predetermined participant predetermined Jin L., Li D., Alesi GN., Fan J., Kang HB., Lu Z., Boggon TJ., Jin P., Yi H., Wright ER., Duong D., Seyfried NT., Egnatchik R., DeBerardinis RJ., Magliocca KR., He C., Arellano ML., Khoury HJ., Shin DM., Khuri FR., Kang S. Cancer - Interactions investigated in the context of cancer EC50 determination in presence of varying concentrations of the allosteric activator ADP, and different amounts of Small Molecule Inhibitors. The GDH1 Activity Assay was used: activity was assessed by monitoring the oxidation of NADPH as a decrease in absorbance at 340 nm after the addition of the (reverse reaction) substrate alpha-KGA. The authors state that all the constructs used are of human origin. smkang@emory.edu Cancer cell 2015 Only protein-protein interactions imex curation imex curation UniProt numbering of protein sequences and mutations has been used, notably; GPX1 mutations given as T143A and D144A have been renumbered to T145A and D146A. jin-2015-1 in vitro In vitro oxidoreduct assay oxidoreductase assay oxidoreduct assay predetermined predetermined participant predetermined Jin L., Li D., Alesi GN., Fan J., Kang HB., Lu Z., Boggon TJ., Jin P., Yi H., Wright ER., Duong D., Seyfried NT., Egnatchik R., DeBerardinis RJ., Magliocca KR., He C., Arellano ML., Khoury HJ., Shin DM., Khuri FR., Kang S. Cancer - Interactions investigated in the context of cancer GDH1 Activity Assay: activity was assessed by monitoring the oxidation of NADPH as a decrease in absorbance at 340 nm after the addition of the (reverse reaction) substrate alpha-KGA. 6PGD enzyme activity was directly determined by measuring the rate of NADPH production. FH activity was determined by measuring the rate of NADPH production by a coupled reaction. The authors state that all the constructs used are of human origin. smkang@emory.edu Cancer cell 2015 Only protein-protein interactions imex curation imex curation UniProt numbering of protein sequences and mutations has been used, notably; GPX1 mutations given as T143A and D144A have been renumbered to T145A and D146A. jin-2015-3 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Jin L., Li D., Alesi GN., Fan J., Kang HB., Lu Z., Boggon TJ., Jin P., Yi H., Wright ER., Duong D., Seyfried NT., Egnatchik R., DeBerardinis RJ., Magliocca KR., He C., Arellano ML., Khoury HJ., Shin DM., Khuri FR., Kang S. Cancer - Interactions investigated in the context of cancer The authors state that all the constructs used are of human origin. smkang@emory.edu Cancer cell 2015 Only protein-protein interactions imex curation imex curation UniProt numbering of protein sequences and mutations has been used, notably; GPX1 mutations given as T143A and D144A have been renumbered to T145A and D146A. jin-2015-6 in vitro In vitro oxidoreduct assay oxidoreductase assay oxidoreduct assay predetermined predetermined participant predetermined Jin L., Li D., Alesi GN., Fan J., Kang HB., Lu Z., Boggon TJ., Jin P., Yi H., Wright ER., Duong D., Seyfried NT., Egnatchik R., DeBerardinis RJ., Magliocca KR., He C., Arellano ML., Khoury HJ., Shin DM., Khuri FR., Kang S. Cancer - Interactions investigated in the context of cancer GPX Assay:-A kit from Biovision was used. GPx1 reduces Cumene Hydroperoxide while oxidizing GSH to GSSG. The generated GSSG is reduced to GSH with consumption of NADPH by GR. This decrease of NADPH is measured at 340 nm and is proportional to GPx1 activity. The authors state that all the constructs used are of human origin. smkang@emory.edu Cancer cell 2015 Only protein-protein interactions imex curation imex curation UniProt numbering of protein sequences and mutations has been used, notably; GPX1 mutations given as T143A and D144A have been renumbered to T145A and D146A. jin-2015-5 in vitro In vitro oxidoreduct assay oxidoreductase assay oxidoreduct assay predetermined predetermined participant predetermined Jin L., Li D., Alesi GN., Fan J., Kang HB., Lu Z., Boggon TJ., Jin P., Yi H., Wright ER., Duong D., Seyfried NT., Egnatchik R., DeBerardinis RJ., Magliocca KR., He C., Arellano ML., Khoury HJ., Shin DM., Khuri FR., Kang S. Cancer - Interactions investigated in the context of cancer 6PGD enzyme activity was directly determined by measuring the rate of NADPH production. The authors state that all the constructs used are of human origin. smkang@emory.edu Cancer cell 2015 Only protein-protein interactions imex curation imex curation UniProt numbering of protein sequences and mutations has been used, notably; GPX1 mutations given as T143A and D144A have been renumbered to T145A and D146A. jin-2015-2 in vitro In vitro pull down pull down tag visualisation tag visualisation Jin L., Li D., Alesi GN., Fan J., Kang HB., Lu Z., Boggon TJ., Jin P., Yi H., Wright ER., Duong D., Seyfried NT., Egnatchik R., DeBerardinis RJ., Magliocca KR., He C., Arellano ML., Khoury HJ., Shin DM., Khuri FR., Kang S. Cancer - Interactions investigated in the context of cancer The authors state that all the constructs used are of human origin. smkang@emory.edu Cancer cell 2015 Only protein-protein interactions imex curation imex curation UniProt numbering of protein sequences and mutations has been used, notably; GPX1 mutations given as T143A and D144A have been renumbered to T145A and D146A. jin-2015-4 in vitro In vitro thermal shift thermal shift binding thermal shift predetermined predetermined participant predetermined Jin L., Li D., Alesi GN., Fan J., Kang HB., Lu Z., Boggon TJ., Jin P., Yi H., Wright ER., Duong D., Seyfried NT., Egnatchik R., DeBerardinis RJ., Magliocca KR., He C., Arellano ML., Khoury HJ., Shin DM., Khuri FR., Kang S. Cancer - Interactions investigated in the context of cancer The authors state that all the constructs used are of human origin. smkang@emory.edu Cancer cell 2015 Only protein-protein interactions imex curation imex curation UniProt numbering of protein sequences and mutations has been used, notably; GPX1 mutations given as T143A and D144A have been renumbered to T145A and D146A. adp adenosine 5'-(trihydrogen diphosphate) (ADP) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) a-kg alpha-ketoglutarate OR 2-OXOGLUTARIC ACID small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) dhe3_human Glutamate dehydrogenase 1, mitochondrial GLUD1 GLUD protein protein human Homo sapiens Human MYRYLGEALLLSRAGPAALGSASADSAALLGWARGQPAAAPQPGLALAARRHYSEAVADREDDPNFFKMVEGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFGDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEADCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGTIPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKVFKVYNEAGVTFT purpurin purpurin 1,2,4-trihydroxy-9,10-anthracenedione 1,2,4-trihydroxy-9,10-anthraquinone 1,2,4-trihydroxyanthra-9,10-quinone 1,2,4-Trihydroxyanthrachinon 1,2,4-trihydroxyanthraquinone C.I. 58205 hydroxylizaric acid Pr Purpurin purpurine smoke Brown G verantin 1,2,4-trihydroxyanthracene-9,10-dione small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) r162 R162 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) (-)-epigallocatechin 3-gallate (-)-epigallocatechin 3-gallate (-)-epigallocatechin-3-O-gallate [(2R,3R)-5,7-dihydroxy-2-(3,4,5-trihydroxyphenyl)-3,4-dihydro-2H-chromen-3-yl] 3,4,5-trihydroxybenzoate EGCG Epigallocatechin 3-gallate (2R,3R)-5,7-dihydroxy-2-(3,4,5-trihydroxyphenyl)-3,4-dihydro-2H-chromen-3-yl 3,4,5-trihydroxybenzoate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 fumaric acid fumaric acid (2E)-2-butenedioic acid (E)-2-butenedioic acid E297 Fumaric acid FUMARIC ACID Fumarsaeure trans-1,2-ethylenedicarboxylic acid trans-but-2-enedioic acid trans-Butenedioic acid (2E)-but-2-enedioic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) fumh_human Fumarate hydratase, mitochondrial FH protein protein human Homo sapiens Human MYRALRLLARSRPLVRAPAAALASAPGLGGAAVPSFWPPNAARMASQNSFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVGTGLNTRIGFAEKVAAKVAALTGLPFVTAPNKFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK gpx1_human Glutathione peroxidase 1 GPX1 Cellular glutathione peroxidase protein protein human Homo sapiens Human MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA mint homomint Protects the hemoglobin in erythrocytes from oxidative breakdown glutathione glutathione gamma-L-Glutamyl-L-cysteinyl-glycine 5-L-Glutamyl-L-cysteinylglycine Glutathione Glutathione-SH GSH N-(N-gamma-L-Glutamyl-L-cysteinyl)glycine Reduced glutathione L-gamma-glutamyl-L-cysteinylglycine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 6-phospho-d-gluconic acid 6-phospho-D-gluconic acid 6-Phospho-D-gluconate 6-O-phosphono-D-gluconic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 6pgd_human 6-phosphogluconate dehydrogenase, decarboxylating PGD PGDH protein protein human Homo sapiens Human MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA (_)_epigallocatechin 3_gallate-a_kg-2 1800501 N/A 1800508 stimulator stimulator neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800509 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800510 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false 1800501 Supp 5J EC50 for this interaction was calculated using the average of the three no-inhibitor values used in figure S5J. a_kg-adp-3 1800501 N/A 1800508 stimulator stimulator neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800511 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800509 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800510 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false 1800501 Supp 5J-2 a_kg-adp-4 1800501 N/A 1800508 stimulator stimulator neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800511 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800509 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800510 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false 1800501 Supp 5J-3 a_kg-adp-5 1800501 N/A 1800508 stimulator stimulator neutral component neutral component N/A 1800512 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800509 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800510 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false 1800501 Supp 5J-5 a_kg-adp-6 1800501 N/A 1800508 stimulator stimulator neutral component neutral component N/A 1800512 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800509 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800510 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false 1800501 Supp 5J-6 (_)_epigallocatechin 3_gallate-a_kg-3 1800501 N/A 1800508 stimulator stimulator neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800513 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800509 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800510 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false 1800501 Supp 5J-8 (_)_epigallocatechin 3_gallate-a_kg-4 1800501 N/A 1800508 stimulator stimulator neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800513 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800509 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800510 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false 1800501 Supp 5J-9 (_)_epigallocatechin 3_gallate-a_kg-5 1800501 N/A 1800514 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800509 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800510 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false 1800501 Supp 5J a_kg-glud1-1 1800502 N/A 1800509 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800510 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false 6B a_kg-glud1-2 1800502 N/A 1800511 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800509 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800510 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false 1800502 1800502 6B-1, Supp 5C/5F+H,I a_kg-glud1-3 1800502 N/A 1800512 unspecified role unspecified role unspecified role unspecified role N/A 1800509 unspecified role unspecified role unspecified role unspecified role N/A 1800510 unspecified role unspecified role unspecified role unspecified role redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false 1800502 1800502 6B, 6G, supp 5F/I R162 acts as a mixed model inhibitor a_kg-glud1-6 1800502 N/A 1800513 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800509 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800510 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false 1800502 Supp 5C/5I weak inhibition shown only. (_)_epigallocatechin 3_gallate-fh-1 1800502 N/A 1800513 stimulator stimulator neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800515 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800516 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false supp 5H-2 (_)_epigallocatechin 3_gallate-fh-2 1800502 N/A 1800515 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800516 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false supp 5H-2i a_kg-glud1-4 1800503 N/A 1800512 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800510 unspecified role unspecified role neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC direct interaction direct interaction false false false 1800503 6C a_kg-glud1-5 1800503 N/A 1800511 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800510 unspecified role unspecified role neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC direct interaction direct interaction false false false 1800503 6C glutathione-gpx1-3 1800504 N/A 1800517 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC N/A 1800518 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false 5B (lower) fumarate glutathione-gpx1-4 1800504 N/A 1800517 enzyme enzyme neutral component neutral component P07203:p.Thr145_Asp146delinsAlaAla mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 1800518 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false 5B (upper), 5E fumarate 6_phospho_d_gluconic acid-pgd-1 1800505 N/A 1800513 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800519 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800520 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false supp 5H (_)_epigallocatechin 3_gallate-6_phospho_d_gluconic acid-1 1800505 N/A 1800519 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800520 enzyme enzyme neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false supp 5Hi fumaric acid-gpx1-1 1800506 N/A 1800517 unspecified role unspecified role bait bait P07203:p.Thr145_Asp146delinsAlaAla mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 1800515 unspecified role unspecified role prey prey region 14c radiolabel 14c radiolabel C14 14C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1800506 5D, Supp 4C/E glud1-r162-1 1800507 N/A 1800512 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1800510 unspecified role unspecified role neutral component neutral component human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC direct interaction direct interaction false false false 6F