IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ tiberi-2014-2 human-daoy Homo sapiens DAOY cerebellar medulloblastoma cell line daoy DAOY cerebellar medulloblastoma cell line ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Tiberi L., Bonnefont J., van den Ameele J., Le Bon SD., Herpoel A., Bilheu A., Baron BW., Vanderhaeghen P. Cancer - Interactions investigated in the context of cancer pierre.vanderhaeghen@ulb.ac.be Cancer cell 2014 Only protein-protein interactions imex curation imex curation tiberi-2014-1 mouse-brain-cerebellum Mus musculus brain cerebellum brain_cerebellum [Cerebellar] ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Tiberi L., Bonnefont J., van den Ameele J., Le Bon SD., Herpoel A., Bilheu A., Baron BW., Vanderhaeghen P. Cancer - Interactions investigated in the context of cancer pierre.vanderhaeghen@ulb.ac.be Cancer cell 2014 Only protein-protein interactions imex curation imex curation tiberi-2014-3 mouse-brain-cerebellum Mus musculus brain cerebellum brain_cerebellum [Cerebellar] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tiberi L., Bonnefont J., van den Ameele J., Le Bon SD., Herpoel A., Bilheu A., Baron BW., Vanderhaeghen P. Cancer - Interactions investigated in the context of cancer The Supplementary Methods for "Western Blot, CoIP, ChIP, ChIP Quantitative PCR" states:- "Cerebellar cells and DAOY cells were fixed with 1% formaldehyde for 15 min at room temperature". This cross-linking has been assumed to apply to the ChIp protocol only, rather than for Western Blots and CoIPs. pierre.vanderhaeghen@ulb.ac.be Cancer cell 2014 Only protein-protein interactions imex curation imex curation gli2_human_gene Human Gli2 Gene gene gene human Homo sapiens Human h14_human Histone H1.4 H1-4 H1F4 HIST1H1E Histone H1b Histone H1s-4 protein protein human Homo sapiens Human MSETAPAAPAAPAPAEKTPVKKKARKSAGAAKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKKAGAAKAKKPAGAAKKPKKATGAATPKKSAKKTPKKAKKPAAAAGAKKAKSPKKAKAAKPKKAPKSPAKAKAVKPKAAKPKTAKPKAAKPKKAAAKKK bcl6_mouse B-cell lymphoma 6 protein homolog Bcl6 Bcl-6 protein protein mouse Mus musculus Mouse MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLSVINLDPEISPEGFCILLDFMYTSRLNLREGNIMAVMTTAMYLQMEHVVDTCRKFIKASEAEMAPALKPPREEFLNSRMLMPHDIMAYRGREVVENNMPLRNTPGCESRAFAPPLYSGLSTPPASYPMYSHLPLSTFLFSDEELRDAPRMPVANPFPKERALPCDSARQVPNEYSRPAMEVSPSLCHSNIYSPKEAVPEEARSDIHYSVPEGPKPAVPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGSEQAELGRLSPRAYPAPPACQPPMEPANLDLQSPTKLSASGEDSTIPQASRLNNLVNRSLAGSPRSSSESHSPLYMHPPKCTSCGSQSPQHTEMCLHTAGPTFPEEMGETQSEYSDSSCENGTFFCNECDCRFSEEASLKRHTLQTHSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEKPYKCETCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHCEKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSAADLPPELPKAC hes5_human_gene Transcription factor HES-5 HES5 BHLHB38 gene gene human Homo sapiens Human sir1_human NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 SIRT1 SIR2L1 SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein human Homo sapiens Human MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS gli1_human_gene Zinc finger protein GLI1 GLI1 GLI gene gene human Homo sapiens Human h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG bcor_human BCL-6 corepressor BCOR KIAA1575 protein protein human Homo sapiens Human MLSATPLYGNVHSWMNSERVRMCGASEDRKILVNDGDASKARLELREENPLNHNVVDASTAHRIDGLAALSMDRTGLIREGLRVPGNIVYSSLCGLGSEKGREAATSTLGGLGFSSERNPEMQFKPNTPETVEASAVSGKPPNGFSAIYKTPPGIQKSAVATAEALGLDRPASDKQSPLNINGASYLRLPWVNPYMEGATPAIYPFLDSPNKYSLNMYKALLPQQSYSLAQPLYSPVCTNGERFLYLPPPHYVGPHIPSSLASPMRLSTPSASPAIPPLVHCADKSLPWKMGVSPGNPVDSHAYPHIQNSKQPRVPSAKAVTSGLPGDTALLLPPSPRPSPRVHLPTQPAADTYSEFHKHYARISTSPSVALSKPYMTVSSEFPAARLSNGKYPKAPEGGEGAQPVPGHARKTAVQDRKDGSSPPLLEKQTVTKDVTDKPLDLSSKVVDVDASKADHMKKMAPTVLVHSRAGSGLVLSGSEIPKETLSPPGNGCAIYRSEIISTAPSSWVVPGPSPNEENNGKSMSLKNKALDWAIPQQRSSSCPRMGGTDAVITNVSGSVSSAGRPASASPAPNANADGTKTSRSSVETTPSVIQHVGQPPATPAKHSSSTSSKGAKASNPEPSFKANENGLPPSSIFLSPNEAFRSPPIPYPRSYLPYPAPEGIAVSPLSLHGKGPVYPHPVLLPNGSLFPGHLAPKPGLPYGLPTGRPEFVTYQDALGLGMVHPMLIPHTPIEITKEEKPERRSRSHERARYEDPTLRNRFSEILETSSTKLHPDVPTDKNLKPNPNWNQGKTVVKSDKLVYVDLLREEPDAKTDTNVSKPSFAAESVGQSAEPPKPSVEPALQQHRDFIALREELGRISDFHETYTFKQPVFTVSKDSVLAGTNKENLGLPVSTPFLEPPLGSDGPAVTFGKTQEDPKPFCVGSAPPSVDVTPTYTKDGADEAESNDGKVLKPKPSKLAKRIANSAGYVGDRFKCVTTELYADSSQLSREQRALQMEGLQEDSILCLPAAYCERAMMRFSELEMKEREGGHPATKDSEMCKFSPADWERLKGNQDKKPKSVTLEEAIAEQNESERCEYSVGNKHRDPFEAPEDKDLPVEKYFVERQPVSEPPADQVASDMPHSPTLRVDRKRKVSGDSSHTETTAEEVPEDPLLKAKRRRVSKDDWPEREMTNSSSNHLEDPHYSELTNLKVCIELTGLHPKKQRHLLHLRERWEQQVSAADGKPGRQSRKEVTQATQPEAIPQGTNITEEKPGRKRAEAKGNRSWSEESLKPSDNEQGLPVFSGSPPMKSLSSTSAGGKKQAQPSCAPASRPPAKQQKIKENQKTDVLCADEEEDCQAASLLQKYTDNSEKPSGKRLCKTKHLIPQESRRGLPLTGEYYVENADGKVTVRRFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSPQETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRDNAGYCALHEACARGWLNIVRHLLEYGADVNCSAQDGTRPLHDAVENDHLEIVRLLLSYGADPTLATYSGRTIMKMTHSELMEKFLTDYLNDLQGRNDDDASGTWDFYGSSVCEPDDESGYDVLANPPGPEDQDDDDDAYSDVFEFEFSETPLLPCYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRCNFPNVEIVTIAEAEFYRQVSASLLFSCSKDLEAFNPESKELLDLVEFTNEIQTLLGSSVEWLHPSDLASDNYW atoh1_human_gene Protein atonal homolog 1 ATOH1 ATH1 BHLHA14 gene gene human Homo sapiens Human gli1_mouse_gene Zinc finger protein GLI1 Gli1 Gli gene gene mouse Mus musculus Mouse gli2_mouse_gene Mouse GLI2 gene gene gene mouse Mus musculus Mouse sir1_mouse NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 Sirt1 Sir2l1 SIR2alpha SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein mouse Mus musculus Mouse MADEVALALQAAGSPSAAAAMEAASQPADEPLRKRPRRDGPGLGRSPGEPSAAVAPAAAGCEAASAAAPAALWREAAGAAASAEREAPATAVAGDGDNGSGLRREPRAADDFDDDEGEEEDEAAAAAAAAAIGYRDNLLLTDGLLTNGFHSCESDDDDRTSHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRILQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRPQKELVHLSELPPTPLHISEDSSSPERTVPQDSSVIATLVDQATNNNVNDLEVSESSCVEEKPQEVQTSRNVENINVENPDFKAVGSSTADKNERTSVAETVRKCWPNRLAKEQISKRLEGNQYLFVPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPLEDESEIEEFYNGLEDDTERPECAGGSGFGADGGDQEVVNEAIATRQELTDVNYPSDKS hes5_mouse_gene Mouse Hes5 gene gene gene mouse Mus musculus Mouse atoh1_mouse_gene Protein atonal homolog 1 gene gene mouse Mus musculus Mouse h14_mouse Histone H1.4 H1-4 H1 VAR.2 H1e H1f4 Hist1h1e protein protein mouse Mus musculus Mouse MSETAPAAPAAPAPAEKTPVKKKARKAAGGAKRKTSGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKRAGAAKAKKPAGAAKKPKKAAGTATAKKSTKKTPKKAKKPAAAAGAKKAKSPKKAKATKAKKAPKSPAKAKTVKPKAAKPKTSKPKAAKPKKTAAKKK h4_mouse Histone H4 H4c11 H4c12 H4c14 H4c2 H4c3 H4c4 H4c6 H4c8 H4c9 H4f16 Hist1h4a Hist4h4 Hist1h4b Hist1h4c Hist1h4d Hist1h4f Hist1h4h Hist1h4i Hist1h4j Hist1h4k Hist2h4a Hist2h4 Hist1h4m H4-53 H4-12 H4c1 protein protein mouse Mus musculus Mouse MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG bcor_mouse BCL-6 corepressor Bcor Kiaa1575 protein protein mouse Mus musculus Mouse MLSATPLYGNVHSWMNSERVRMCGTSEDRKIPVNDGDASKARLELREETPLSHSVVDTSGAHRIDGLAALSMDRTGLIREGLRVPGNIVYSGLCGLGSEKGREATPSSLSGLGFSSERNPEMQFKPNTPETVEASAVSGKPPNGFSAIYKTPPGIQKSAVATAESLGLDRPASDKQSPLNINGASYLRLPWVNPYMEGATPAIYPFLDSPNKYSLNMYKALLPQQSYGLAQPLYSPVCTSGERFLYLPPPHYVNPHIPSSLASPMRLSTPSASAAIPPLVHCSDKSLPWKMGVNPGNPVDSHSYPHIQNSKQPRVTSAKAVNSGLPGDTALLLPPSPRPSARVHLPTQPAAETYSEFHKHYPRISTSPSVTLTKPYMTANSEFSTSRLSNGKYPKALDGGDCAQSMPGHTRKTTVQDRKDGGSPPLLEKQTVTKDVTDKPLDLSSKVVDADASKGDHMKKMAPTVLVHSRAASGLVLSGSEIPKETLSPPGNGCSIYRSEIISTAPSSWVVPGPSPNEENNGKSLSLKNKALDWAIPQQRSSSCPRMGGTDAVVTNVSGSVSSSGRPASASPAPNANANADGTKTSRSSVDTTPSVIQHVGQPSSTPAKHGGSTSSKGAKANPEPSFKASENGLPPTSIFLSPNEAFRSPAIPYPRSYLPYAAPEGIALSPLSLHGKGPVYPHPVLLPNGSLFPGHLAPKPGLPYGLHTSRPEFVTYQDALGLGMVHPMLIPHTPIEITKEEKPERRSRSHERARYEDPTLRSRFSEMLEASSTKLHPEVPTDKNLKPNSSWNQGKTGVKSDKLVYVDLLREEADTKTDAGAPKAGLVAENVGQDTEATKPSADPVIQQRREFISLREELGRITDFHESFTFKQASSQPVFSLGKDSGAAGTNKENLGVQVATPFLETALGSEGPAVTFGKTQEDPKPFCVGGAPPNMDVTPAYTKEGTDEAESNDGKVLKPKPSKLAKRIANSAGYVGDRFKCVTTELYADSSQLSREQRALQMEGLQEDSILCLPAAYCERAMMRFSELEMKEREGSHPATKDSEVCKFSPADWERLKGNQEKKPKSVTLEEAIADQNDSERCEYSTGNKHDLFEAPEDKDLPVEKYFLERPPVSEPPSDQGVVDTPHSPTLRLDRKRKLSGDSTHTETAVEELAEDPLKAKRRRISKDDWPEREMTNSSSNHLEDPHCNELTNLKVCIELTGLHPKKQRHLLHLRERWEQQVSAAESKPGRQSRKEVAQAVQPEVTSQGTNITEEKPGRKKAEAKGNRGWSEESLKSCDNEQGLPVLSGSPPMKSLSSTNASGKKQTQPSCTPASRLPAKQQKIKESQKTDVLCTGEDEDCQAASPLQKYTDNIEKPSGKRLCKTKHLIPQESRRSLQITGDYYVENTDTKMTVRRFRKRPEPSSDYDLSPPAKQEPKPFDRLQQLLPATQATQLPRSNSPQETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKVCDVNHRDNAGYCALHEACARGWLNIVRHLLEYGADVNCSAQDGTRPLHDAVENDHLEIVRLLLSYGADPTLATYSGRTIMKMTHSELMEKFLTDYLNDLQGRSEDDTSGAWEFYGSSVCEPDDESGYDVLANPPGPEDPDEEEDTYSDLFEFEFAESSLLPCYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRSNFPNLEIVTIAEAEFYRQVSTSLLFSCPKDLEAFNPESKELLDLVEFTNELQTLLGSSVEWLHPSDTGHENYW hist1h1e-gli2_human_gene-1 1796447 N/A 1796450 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796451 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false association association false false false 4J Decreased binding to the Intron1 region was observed using Bcl6 transfected cells;however both transfected and non-transfected cells showed significant binding to the proximal promoter regions. bcl6-gli2_human_gene-1 1796447 N/A 1796450 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796452 unspecified role unspecified role bait bait association association false false false 4G Increased binding was seen using Bcl6 transfected cells. P41183 decreases expression at RNA level of ENSG00000074047 sirt1-hes5_mouse_gene-2 1796447 N/A 1796453 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796454 unspecified role unspecified role bait bait association association false false false 4I A slight increase in binding above background was seen for both Bcl6 transfected and non-transfected cells; however there was no significant difference in binding between these cells. sirt1-gli1-4 1796447 N/A 1796455 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796454 unspecified role unspecified role bait bait association association false false false 4I Increased binding was seen using Bcl6 transfected cells. sirt1-gli2_mouse_gene-2 1796447 N/A 1796450 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796454 unspecified role unspecified role bait bait association association false false false 4I Increased binding was seen using Bcl2 transfected cells. hist1h1e-gli1-1 1796447 N/A 1796455 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796451 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false association association false false false 4J Decreased binding was observed using Bcl6 transfected cells. hist1h4a-gli1-1 1796447 N/A 1796455 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796456 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false association association false false false 4K Decreased binding was seen using Bcl6 transfected cells. bcl6-gli1-3 1796447 N/A 1796455 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796452 unspecified role unspecified role bait bait association association false false false 4G An increase in binding was seen using Bcl6 transfected cells. P41183 decreases expression at RNA level of ENSG00000111087 bcor-gli1-1 1796447 N/A 1796455 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796457 unspecified role unspecified role bait bait association association false false false 4H Increased binding was seen using Bcl6 transfected cells. bcor-gli2_mouse_gene-1 1796447 N/A 1796450 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796457 unspecified role unspecified role bait bait association association false false false 4H Increased binding was seen using Bcl6 transfected cells. hist1h1e-atoh1-1 1796447 N/A 1796458 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796451 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false association association false false false 4J A slight increase in binding above background was seen for both Bcl6 transfected and non-transfected cells; however there was no significant difference in binding between these cells. hist1h4a-atoh1-1 1796447 N/A 1796458 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796456 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false association association false false false 4K A slight increase in binding above background was seen for both Bcl6 transfected and non-transfected cells; however there was no significant difference in binding between these cells. hist1h1e-hes5-1 1796447 N/A 1796453 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796451 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false association association false false false 4J A slight increase in binding above background was seen for both Bcl6 transfected and non-transfected cells; however there was no significant difference in binding between these cells. hist1h4a-gli2_human_gene-1 1796447 N/A 1796450 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796456 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false association association false false false 4K Using Bcl6 transfected cells decreased binding was seen at the Intron 1 binding region;however at the proximal promoter binding regions an increase in binding above background was seen for both Bcl6 transfected and non-transfected cells, with no significant difference in binding between the cells. hist1h4a-hes5-1 1796447 N/A 1796453 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796456 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false association association false false false 4K A slight increase in binding above background was seen for both Bcl6 transfected and non-transfected cells; however there was no significant difference in binding between these cells. bcl6-gli1-1 1796448 N/A 1796459 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796452 unspecified role unspecified role bait bait association association false false false 3B Little binding was observed using Bcl6 KO mice. bcl6-gli2_mouse_gene-2 1796448 N/A 1796460 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796452 unspecified role unspecified role bait bait association association false false false 3B-2 Little binding was observed using Bcl6 KO mice. sirt1-gli2_mouse_gene-1 1796448 N/A 1796460 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796461 unspecified role unspecified role bait bait association association false false false 3C Reduced binding was observed using Bcl6 KO mice. sirt1-gli1-1 1796448 N/A 1796459 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796461 unspecified role unspecified role bait bait association association false false false 3C Reduced binding was observed using Bcl6 KO mice. sirt1-hes5_mouse_gene-1 1796448 N/A 1796462 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796461 unspecified role unspecified role bait bait association association false false false 3Ci No significant reduction of binding was observed using Bcl6 KO mice. sirt1-atoh1_mouse_gene-1 1796448 N/A 1796463 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796461 unspecified role unspecified role bait bait association association false false false 3Cii No significant reduction in binding was observed using Bcl6 KO mice. hist1h1e-atoh1_mouse_gene-1 1796448 N/A 1796463 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796464 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false association association false false false 3D No significant reduction in binding was observed using Bcl6 KO mice. sirt1-gli1-2 1796448 N/A 1796459 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796464 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false association association false false false 3D Increased binding was observed using Bcl6 KO mice. hist1h1e-gli2_mouse_gene-1 1796448 N/A 1796460 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796464 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false association association false false false 3D Increased binding was observed using Bcl6 KO mice. hist1h1e-gli2_mouse_gene-2 1796448 N/A 1796460 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796465 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false association association false false false 3E Increased binding was observed using Bcl6 KO mice. sirt1-gli1-3 1796448 N/A 1796459 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796465 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false association association false false false 3E Increased binding was observed using Bcl6 KO mice. bcl6-gli1-2 1796448 N/A 1796459 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796466 unspecified role unspecified role bait bait association association false false false 3F Little binding was observed using Bcl6 KO mice. bcl6-gli2_mouse_gene-1 1796448 N/A 1796460 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1796466 unspecified role unspecified role bait bait association association false false false 3F Little binding was observed using Bcl6 KO mice. sirt1-bcl6-2 1796449 N/A 1796452 unspecified role unspecified role prey prey N/A 1796461 unspecified role unspecified role bait bait physical association physical association false false false Supp Fig 3A sirt1-bcl6-1 1796449 N/A 1796452 unspecified role unspecified role bait bait N/A 1796466 unspecified role unspecified role prey prey physical association physical association false false false Supp Fig 3B bcor-bcl6-1 1796449 N/A 1796461 unspecified role unspecified role prey prey N/A 1796452 unspecified role unspecified role prey prey N/A 1796466 unspecified role unspecified role bait bait association association false false false Supp Fig 3C This interaction did not occur in Bcl6 KO mice cells.