IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lee-2013e-2 Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lee Y.S., Lee J.W., Jang J.W., Chi X.Z., Kim J.H., Li Y.H., Kim M.K., Kim D.M., Choi B.S., Kim E.G., Chung J.H., Lee O.J., Lee Y.M., Suh J.W., Chuang L.S., Ito Y., Bae S.C. Cancer - Interactions investigated in the context of cancer Molecules/Genes in CAPITAL letters have been entered as Human in origin, and lower case molecules/Genes as Murine in origin, as used throughout this publication. csiitoy@nus.edu.sg,scbae@chungbuk.ac.kr Time after addition of 10% serum. (origin of serum is undisclosed) Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation lee-2013e-3 Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lee Y.S., Lee J.W., Jang J.W., Chi X.Z., Kim J.H., Li Y.H., Kim M.K., Kim D.M., Choi B.S., Kim E.G., Chung J.H., Lee O.J., Lee Y.M., Suh J.W., Chuang L.S., Ito Y., Bae S.C. Cancer - Interactions investigated in the context of cancer Cyclin D and p300 both have an HA tag; when both are present it has been assumed their presence/absence after an IP has been demonstrated by the molecular weight of the respective bands. Molecules/Genes in CAPITAL letters have been entered as Human in origin, and lower case molecules/Genes as Murine in origin, as used throughout this publication. csiitoy@nus.edu.sg,scbae@chungbuk.ac.kr Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation lee-2013e-1 Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lee Y.S., Lee J.W., Jang J.W., Chi X.Z., Kim J.H., Li Y.H., Kim M.K., Kim D.M., Choi B.S., Kim E.G., Chung J.H., Lee O.J., Lee Y.M., Suh J.W., Chuang L.S., Ito Y., Bae S.C. Cancer - Interactions investigated in the context of cancer Cyclin D and p300 both have an HA tag; when both are present it has been assumed their presence/absence after an IP has been demonstrated by the molecular weight of the respective bands. Molecules/Genes in CAPITAL letters have been entered as Human in origin, and lower case molecules/Genes as Murine in origin, as used throughout this publication. csiitoy@nus.edu.sg,scbae@chungbuk.ac.kr Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation lee-2013e-4 Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lee Y.S., Lee J.W., Jang J.W., Chi X.Z., Kim J.H., Li Y.H., Kim M.K., Kim D.M., Choi B.S., Kim E.G., Chung J.H., Lee O.J., Lee Y.M., Suh J.W., Chuang L.S., Ito Y., Bae S.C. Cancer - Interactions investigated in the context of cancer Molecules/Genes in CAPITAL letters have been entered as Human in origin, and lower case molecules/Genes as Murine in origin, as used throughout this publication. csiitoy@nus.edu.sg,scbae@chungbuk.ac.kr Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation lee-2013e-5 Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Lee Y.S., Lee J.W., Jang J.W., Chi X.Z., Kim J.H., Li Y.H., Kim M.K., Kim D.M., Choi B.S., Kim E.G., Chung J.H., Lee O.J., Lee Y.M., Suh J.W., Chuang L.S., Ito Y., Bae S.C. Cancer - Interactions investigated in the context of cancer Molecules/Genes in CAPITAL letters have been entered as Human in origin, and lower case molecules/Genes as Murine in origin, as used throughout this publication. csiitoy@nus.edu.sg,scbae@chungbuk.ac.kr Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation lee-2013e-6 Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. human-h460 Homo sapiens non-small-cell lung cancer cell line H460 h460 human non-small-cell lung cancer cell line H460 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Lee Y.S., Lee J.W., Jang J.W., Chi X.Z., Kim J.H., Li Y.H., Kim M.K., Kim D.M., Choi B.S., Kim E.G., Chung J.H., Lee O.J., Lee Y.M., Suh J.W., Chuang L.S., Ito Y., Bae S.C. Cancer - Interactions investigated in the context of cancer Molecules/Genes in CAPITAL letters have been entered as Human in origin, and lower case molecules/Genes as Murine in origin, as used throughout this publication. csiitoy@nus.edu.sg,scbae@chungbuk.ac.kr Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation lee-2013e-7 Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Lee Y.S., Lee J.W., Jang J.W., Chi X.Z., Kim J.H., Li Y.H., Kim M.K., Kim D.M., Choi B.S., Kim E.G., Chung J.H., Lee O.J., Lee Y.M., Suh J.W., Chuang L.S., Ito Y., Bae S.C. Cancer - Interactions investigated in the context of cancer Molecules/Genes in CAPITAL letters have been entered as Human in origin, and lower case molecules/Genes as Murine in origin, as used throughout this publication. csiitoy@nus.edu.sg,scbae@chungbuk.ac.kr Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation brd2_human Bromodomain-containing protein 2 BRD2 KIAA9001 RING3 O27.1.1 Really interesting new gene 3 protein protein protein human Homo sapiens Human MLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPANPPPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGPPLLAVTAAPPAQPLAKKKGVKRKADTTTPTPTAILAPGSPASPPGSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLEPGPLPVSTAMPPGLAKSSSESSSEESSSESSSEEEEEEDEEDEEEEESESSDSEEERAHRLAELQEQLRAVHEQLAALSQGPISKPKRKREKKEKKKKRKAEKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAALGPSGFGPSGGSGTKLPKKATKTAPPALPTGYDSEEEEESRPMSYDEKRQLSLDINKLPGEKLGRVVHIIQAREPSLRDSNPEEIEIDFETLKPSTLRELERYVLSCLRKKPRKPYTIKKPVGKTKEELALEKKRELEKRLQDVSGQLNSTKKPPKKANEKTESSSAQQVAVSRLSASSSSSDSSSSSSSSSSSDTSDSDSG runx3_human Runt-related transcription factor 3 RUNX3 AML2 CBFA3 PEBP2A3 Core-binding factor subunit alpha-3 Acute myeloid leukemia 2 protein Oncogene AML-2 Polyomavirus enhancer-binding protein 2 alpha C subunit SL3-3 enhancer factor 1 alpha C subunit SL3/AKV core-binding factor alpha C subunit protein protein human Homo sapiens Human MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY ep300_human Histone acetyltransferase p300 Histone butyryltransferase p300 Histone crotonyltransferase p300 Protein propionyltransferase p300 EP300 P300 E1A-associated protein p300 Protein 2-hydroxyisobutyryltransferase p300 Protein lactyltransferas p300 protein protein human Homo sapiens Human MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKAVPGGGMPNMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQPILTGAPVGLGNPSSLGVGQQSAPNLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQNPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSMAQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPSLPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQAIAEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELKTEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHLEPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGISPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPIPGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYPPQQQQRMQHHMQQMQQGNMGQIGQLPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH hdac4_human Histone deacetylase 4 HDAC4 KIAA0288 protein protein human Homo sapiens Human MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLPVAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGPSSPNNSSGSVSAENGIAPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPATGPSAGTAGQQDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLLEQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHLVIQQQHQQFLEKHKQQFQQQQLQMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPYLDRLPGQKEAHAQAGVQVKQEPIESDEEEAEPPREVEPGQRQPSEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPVSVQEPPTKPRFTTGLVYDTLMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWDVHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKVMEIHSKYWRCLQRTTSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDEEPMEEEPPL ccnd1_human G1/S-specific cyclin-D1 CCND1 BCL1 PRAD1 PRAD1 oncogene BCL-1 oncogene B-cell lymphoma 1 protein protein protein human Homo sapiens Human MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI hdac5_human Histone deacetylase 5 Antigen NY-CO-9 HDAC5 KIAA0600 protein protein human Homo sapiens Human MNSPNESDGMSGREPSLEILPRTSLHSIPVTVEVKPVLPRAMPSSMGGGGGGSPSPVELRGALVGSVDPTLREQQLQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQQEMLAAKQQQEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKEKSKESAIASTEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGPPGTPPSYKLPLPGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVISTFKKRAVEITGAGPGASSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHRALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATSMRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTGELPRQPTTHPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEEDCIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLATVPHQALGRTQSSPAAPGGMKSPPDQPVKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQETGLLSKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAVLPCGGIGVDSDTVWNEMHSSSAVRMAVGCLLELAFKVAAGELKNGFAIIRPPGHHAEESTAMGFCFFNSVAITAKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNFFPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLVSAGFDAVEGHLSPLGGYSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVSALLSVELQPLDEAVLQQKPNINAVATLEKVIEIQSKHWSCVQKFAAGLGRSLREAQAGETEEAETVSAMALLSVGAEQAQAAAAREHSPRPAEEPMEQEPAL brd2-runx3-1 1461082 n/a 1461089 unspecified role unspecified role bait bait n/a 1461090 unspecified role unspecified role prey prey physical association physical association false false false 5A/D, 6A Acetylation of RUNX3 and formation of the RUNX3-BRD2 complex peaked after 2 hr of stimulation and declined after 4 hr 1-4 hours Expression of K-RasG12V triggered the formation of the BRD2/RUNX3 complex and prolonged the duration of this interaction. runx3-brd2-5 1461082 n/a 1461091 unspecified role unspecified role prey prey n/a 1461089 unspecified role unspecified role prey prey n/a 1461090 unspecified role unspecified role bait bait association association false false false 6Ai lanes 2+3 1-2 hours Expression of K-RasG12V triggered the formation of the BRD2/RUNX3 complex and prolonged the duration of this interaction. brd2-ep300-1 1461082 n/a 1461092 unspecified role unspecified role prey prey n/a 1461090 unspecified role unspecified role bait bait physical association physical association false false false 5A 0 time runx3-ccnd1 1461082 n/a 1461093 unspecified role unspecified role prey prey n/a 1461092 unspecified role unspecified role prey prey n/a 1461090 unspecified role unspecified role bait bait n/a 1461091 unspecified role unspecified role prey prey association association false false false 5A/D 1-4 hours Knockdown of Cyclin D1 inhibited deacetylation of RUNX3 and dissociation of the RUNX3-BRD2 complex and prolonged the expression of ARF and p21. runx3-ccnd1-1 1461082 n/a 1461093 unspecified role unspecified role prey prey n/a 1461090 unspecified role unspecified role bait bait n/a 1461092 unspecified role unspecified role prey prey association association false false false 5A 8 hours runx3-ccnd1-3 1461082 n/a 1461093 unspecified role unspecified role prey prey n/a 1461092 unspecified role unspecified role prey prey n/a 1461090 unspecified role unspecified role bait bait association association false false false 6A lanes 4+5 4-8 hours RUNX3-Cyclin D1 and RUNX3-HDAC4 interactions were markedly reduced in cells expressing K-RasG12V. runx3-ccnd1-2 1461083 n/a 1461093 weight identificat confirmation by molecular weight weight identificat unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1461094 unspecified role unspecified role prey prey n/a 1461091 weight identificat confirmation by molecular weight weight identificat unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1461092 unspecified role unspecified role prey prey n/a 1461090 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5E lanes 6,7,8. Cyclin D1 facilitated the release of p300 from RUNX3 and promoted the RUNX3-HDAC4 interaction but not the RUNX3-HDAC5 interaction. runx3-ep300 1461083 n/a 1461094 unspecified role unspecified role prey prey n/a 1461090 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5Ei lane 3 runx3-ep300-2 1461083 n/a 1461093 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1461094 unspecified role unspecified role prey prey n/a 1461092 unspecified role unspecified role prey prey n/a 1461090 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5E lane 4 Cyclin D1 facilitated the release of p300 from RUNX3 and promoted the RUNX3-HDAC4 interaction but not the RUNX3-HDAC5 interaction. runx3-ep300-4 1461083 n/a 1461094 unspecified role unspecified role prey prey n/a 1461090 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1461091 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5E lane 5 Cyclin D1 facilitated the release of p300 from RUNX3 and promoted the RUNX3-HDAC4 interaction but not the RUNX3-HDAC5 interaction. runx3-ccnd1-5 1461083 n/a 1461092 unspecified role unspecified role prey prey n/a 1461090 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1461093 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 6 Lane 2ii HA-p300 was not detected. runx3-ccnd1-6 1461083 n/a 1461091 weight identificat confirmation by molecular weight weight identificat unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1461092 unspecified role unspecified role prey prey n/a 1461093 weight identificat confirmation by molecular weight weight identificat unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1461090 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 6 lanes 4 and 5 The presence of MEK1-CA reduced this interaction and disrupted it completely at the highest concentration of MEK1-CA. This interaction did not occur in the absence of CyclinD1. brd2-runx3 1461084 n/a 1461090 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q13761:p.[Lys94Arg;Lys171Arg] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q13761:p.Lys171Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q13761:p.Lys94Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q13761:p.[Lys87Arg;Lys94Arg;Lys129Arg;Lys148Arg;Lys171Arg;Lys186Arg] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1461089 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bromo1_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 4F/G, 5B/C, 6E, Supp. 4 H and G. HA-p300 Supplementary Figure 4H gives details for deletion constructs of (human) BRD2; however the sequences are given in relation to a 802 amino acid protein which cannot be traced. (this protein has been asssumed to be human as no other species appears to have an 802 amino acid BRD2 protein- the human protein has 801 amino acids.). In cells expressing K-RasG12V and MEK1-CA the BRD2-RUNX3 interaction and expression of p21 and ARF was maintained. In cells expressing Myc-RUNX3-KR-94-171, (which cannot form the RUNX3-BRD2 complex), K-RasG12V and MEK1-CA failed to induce ARF and p21. runx3-ccnd1-7 1461084 n/a 1461090 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1461092 unspecified role unspecified role prey prey n/a 1461094 unspecified role unspecified role prey prey n/a 1461091 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1461093 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5E HA-p300 brd2-runx3-6 1461084 n/a 1461089 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1461090 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp 6 Lane 1i and lanes 3-6 The additional presence of HA-Cyclin D1 (lane 2) disrupted this interaction. The presence of MEK1-CA did not disrupt this interaction. runx3-ccnd1-4 1461084 n/a 1461090 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1461091 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp 6 Lane 1ii, lanes 3 and 6. The presence of MEK1-CA blocked the interaction with Cyclin D1 and HDAC4. brd2-runx3-2 1461085 n/a 1461090 unspecified role unspecified role prey prey n/a 1461089 unspecified role unspecified role bait bait physical association physical association false false false 7A The RUNX3-BRD2 complex was formed and stably maintained due to the endogenous oncogenic K-Ras. brd2-runx3-3 1461086 n/a 1461089 unspecified role unspecified role bait bait n/a 1461090 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q13761:p.[Lys94Arg;Lys171Arg] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 7B brd2-runx3-4 1461087 n/a 1461090 unspecified role unspecified role prey prey Q13761:p.[Lys94Arg;Lys171Arg] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1461089 unspecified role unspecified role bait bait physical association physical association false false false 7C In a cell line that expresses little or no RUNX3 (or ARF,p21 or p53) (over) expression of RUNX3 resulted in formation of a stable RUNX3-BRD2 complex and expression of ARF, p21, and p53, -whereas the (over) expression of RUNX3-KR-94-171 did not. brd2-runx3-5 1461088 n/a 1461090 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1461089 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Supp 5A