IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kollmann-2013-1 A Kinase-Independent Function of CDK6 Links the Cell Cycle to Tumor Angiogenesis. mouse-pro b cells Mus musculus pro-b-cell pro b cell ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Kollmann K., Heller G., Schneckenleithner C., Warsch W., Scheicher R., Ott R.G., Schäfer M., Fajmann S., Schlederer M., Schiefer A.I., Reichart U., Mayerhofer M., Hoeller C., Zöchbauer-Müller S., Kerjaschki D., Bock C., Kenner L., Hoefler G., Freissmuth M., Green A.R., Moriggl R., Busslinger M., Malumbres M., Sexl V. Cancer - Interactions investigated in the context of cancer Interactions using antibodies to H3 have not been included owing to lack of antibody specificity. p185 BCR-ABL-transformed pro B cell line infected with a retrovirus to express CDK6, HA-tagged CDK6 or the CDK6K43M mutant. veronika.sexl@vetmeduni.ac.at Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation kollmann-2013-3 A Kinase-Independent Function of CDK6 Links the Cell Cycle to Tumor Angiogenesis. mouse-pro b cells Mus musculus pro-b-cell pro b cell ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Kollmann K., Heller G., Schneckenleithner C., Warsch W., Scheicher R., Ott R.G., Schäfer M., Fajmann S., Schlederer M., Schiefer A.I., Reichart U., Mayerhofer M., Hoeller C., Zöchbauer-Müller S., Kerjaschki D., Bock C., Kenner L., Hoefler G., Freissmuth M., Green A.R., Moriggl R., Busslinger M., Malumbres M., Sexl V. Cancer - Interactions investigated in the context of cancer Interactions using antibodies to H3 have not been included owing to lack of antibody specificity. p185 BCR-ABL-transformed pro B cell line infected with a retrovirus to express CDK6, HA-tagged CDK6 or the CDK6K43M mutant. veronika.sexl@vetmeduni.ac.at Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation kollmann-2013-2 A Kinase-Independent Function of CDK6 Links the Cell Cycle to Tumor Angiogenesis. mouse-pro b cells Mus musculus pro-b-cell pro b cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kollmann K., Heller G., Schneckenleithner C., Warsch W., Scheicher R., Ott R.G., Schäfer M., Fajmann S., Schlederer M., Schiefer A.I., Reichart U., Mayerhofer M., Hoeller C., Zöchbauer-Müller S., Kerjaschki D., Bock C., Kenner L., Hoefler G., Freissmuth M., Green A.R., Moriggl R., Busslinger M., Malumbres M., Sexl V. Cancer - Interactions investigated in the context of cancer Interactions using antibodies to H3 have not been included owing to lack of antibody specificity. p185 BCR-ABL-transformed pro B cell line infected with a retrovirus to express CDK6, HA-tagged CDK6 or the CDK6K43M mutant. veronika.sexl@vetmeduni.ac.at Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation kollmann-2013-4 A Kinase-Independent Function of CDK6 Links the Cell Cycle to Tumor Angiogenesis. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Kollmann K., Heller G., Schneckenleithner C., Warsch W., Scheicher R., Ott R.G., Schäfer M., Fajmann S., Schlederer M., Schiefer A.I., Reichart U., Mayerhofer M., Hoeller C., Zöchbauer-Müller S., Kerjaschki D., Bock C., Kenner L., Hoefler G., Freissmuth M., Green A.R., Moriggl R., Busslinger M., Malumbres M., Sexl V. Cancer - Interactions investigated in the context of cancer Interactions using antibodies to H3 have not been included owing to lack of antibody specificity. p185 BCR-ABL-transformed pro B cell line infected with a retrovirus to express CDK6, HA-tagged CDK6 or the CDK6K43M mutant. veronika.sexl@vetmeduni.ac.at Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation cdk6_mouse Cyclin-dependent kinase 6 Serine/threonine-protein kinase PLSTIRE Cdkn6 Cdk6 Crk2 Cell division protein kinase 6 CR2 protein kinase protein protein mouse Mus musculus Mouse MEKDSLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTSEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDIIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYGALNHPYFQDLERYKDNLNSHLPSNQSTSELNTA cd2a2_mouse_gene Cyclin-dependent kinase inhibitor 2A gene gene mouse Mus musculus Mouse vegfa_mouse_gene Mouse VEGFA gene gene gene mouse Mus musculus Mouse rpb1_mouse DNA-directed RNA polymerase II subunit RPB1 Polr2a Rpii215 Rpo2-1 DNA-directed RNA polymerase II subunit A DNA-directed RNA polymerase III largest subunit protein protein mouse Mus musculus Mouse MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPASPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN stat3_mouse Signal transducer and activator of transcription 3 Acute-phase response factor Stat3 Aprf protein protein mouse Mus musculus Mouse MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMDLTSECATSPM jun_mouse Transcription factor AP-1 Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog AH119 Jun protein protein mouse Mus musculus Mouse MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF ccnd2_mouse G1/S-specific cyclin-D2 Ccnd2 Cyl-2 protein protein mouse Mus musculus Mouse MELLCCEVDPVRRAVPDRNLLEDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTAEKLCIYTDNSVKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQKEKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDDEVNTLTCDALTELLAKITHTDVDCLKACQEQIEALLLNSLQQFRQEQHNAGSKSVEDPDQATTPTDVRDVDL ccnd3_mouse G1/S-specific cyclin-D3 Ccnd3 Cyl-3 protein protein mouse Mus musculus Mouse MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQKEIKPHMRKMLAYWMLEVCEEQRCEEDVFPLAMNYLDRYLSCVPTRKAQLQLLGTVCLLLASKLRETTPLTIEKLCIYTDQAVAPWQLREWEVLVLGKLKWDLAAVIAHDFLALILHRLSLPSDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVLGLGACSMSADELTELLAGITGTEVDCLRACQEQIEAALRESLREAAQTAPSPVPKAPRGSSSQGPSQTSTPTDVTAIHL cdk4_mouse Cyclin-dependent kinase 4 Cell division protein kinase 4 PSK-J3 CRK3 Cdk4 Crk3 protein protein mouse Mus musculus Mouse MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALLRRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPREVSLPRGAFAPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEESDAE cdk6-cd2a2 1434737 n/a 1434741 unspecified role unspecified role bait bait Q64261:p.Lys43Met mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n/a 1434742 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 2D, Supp 6I cdk6-cd2a2-1 1434737 n/a 1434741 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1434743 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6C cdk6-vegfa 1434737 n/a 1434741 unspecified role unspecified role bait bait n/a 1434743 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D, Supp 6I polr2a-vegfa 1434737 n/a 1434744 unspecified role unspecified role bait bait n/a 1434743 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1434741 unspecified role unspecified role ancillary ancillary association association false false false Supp 6I cdk6-cd2a2-2 1434737 n/a 1434742 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1434745 unspecified role unspecified role bait bait association association false false false Supp 7B cdk6-vegfa-1 1434737 n/a 1434745 unspecified role unspecified role bait bait n/a 1434743 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 7B cdk6-vegfa-2 1434737 n/a 1434746 unspecified role unspecified role bait bait n/a 1434743 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 7C jun-cdk6 1434738 n/a 1434746 unspecified role unspecified role bait bait n/a 1434743 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1434741 unspecified role unspecified role prey prey association association false false false 7G stat3-cd2a2 1434738 n/a 1434745 unspecified role unspecified role bait bait n/a 1434741 unspecified role unspecified role prey prey n/a 1434742 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 7G jun-cdk6-1 1434738 n/a 1434745 unspecified role unspecified role bait bait n/a 1434741 unspecified role unspecified role prey prey n/a 1434743 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 7Gi stat3-cd2a2-1 1434738 n/a 1434747 unspecified role unspecified role bait bait n/a 1434741 unspecified role unspecified role prey prey n/a 1434742 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 7E Using CDK KO cells Cyclin 2 does not bind to either Vegf-A or p16INK4a promoter. stat3-cdk6-2 1434738 n/a 1434747 unspecified role unspecified role bait bait n/a 1434741 unspecified role unspecified role prey prey n/a 1434743 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 7E Using CDK KO cells Cyclin 2 does not bind to either Vegf-A or p16INK4a promoter. stat3-cdk6 1434739 n/a 1434741 unspecified role unspecified role prey prey n/a 1434745 unspecified role unspecified role bait bait physical association physical association false false false 7A stat3-cdk6-1 1434739 n/a 1434746 unspecified role unspecified role bait bait n/a 1434741 unspecified role unspecified role prey prey physical association physical association false false false 7B cdk6-ccnd2-1 1434739 n/a 1434748 unspecified role unspecified role prey prey n/a 1434747 unspecified role unspecified role prey prey n/a 1434741 unspecified role unspecified role bait bait association association false false false Supp 7D cdk6-ccnd2-2 1434739 n/a 1434749 unspecified role unspecified role bait bait n/a 1434747 unspecified role unspecified role prey prey n/a 1434748 unspecified role unspecified role prey prey association association false false false Supp 7Di ccnd2-cdk6 1434740 n/a 1434741 unspecified role unspecified role bait bait n/a 1434742 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 7F Using cyclin 1/2/3 KO cells CDK6 still binds to the p16INK4a promoter. ccnd2-cd2a2-1 1434740 n/a 1434747 unspecified role unspecified role bait bait n/a 1434742 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 7Fi