IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mulero-2013-4 Chromatin-Bound IKBA Regulates a Subset of Polycomb Target Genes in Differentiation and Cancer. mouse-keratinocyte Mouse Keratinocyte keratinocyte Keratinocyte ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Mulero M.C., Ferres-Marco D., Islam A., Margalef P., Pecoraro M., Toll A., Drechsel N., Charneco C., Davis S., Bellora N., Gallardo F., Lopez-Arribillaga E., Asensio-Juan E., Rodilla V., Gonzalez J., Iglesias M., Shih V., Mar Alba  M., Di Croce L., Hoffmann A., Miyamoto S., Villa -Freixa J., Lopez-Bigas N., Keyes W.M., Dominguez M., Bigas A., Espinosa L. Chromatin - Epigenetic interactions resulting in chromatin modulation The origin of the HA-IkBa and mutants, Histone H2 extract, plus other constructs, notably -His-SUMOs, GST-IKBA, HA-SUZ12, HA-IKBA (delta 55-102) and GST-H4 could not be found in the references given, references quoted therein and previous work by principal authors. The authors did not respond to a request for information. lespinosa@imim.es Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer mulero-2013-5 Chromatin-Bound IKBA Regulates a Subset of Polycomb Target Genes in Differentiation and Cancer. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Mulero M.C., Ferres-Marco D., Islam A., Margalef P., Pecoraro M., Toll A., Drechsel N., Charneco C., Davis S., Bellora N., Gallardo F., Lopez-Arribillaga E., Asensio-Juan E., Rodilla V., Gonzalez J., Iglesias M., Shih V., Mar Alba  M., Di Croce L., Hoffmann A., Miyamoto S., Villa -Freixa J., Lopez-Bigas N., Keyes W.M., Dominguez M., Bigas A., Espinosa L. Chromatin - Epigenetic interactions resulting in chromatin modulation The origin of the HA-IkBa and mutants, Histone H2 extract, plus other constructs, notably -His-SUMOs, GST-IKBA, HA-SUZ12, HA-IKBA (delta 55-102) and GST-H4 could not be found in the references given, references quoted therein and previous work by principal authors. The authors did not respond to a request for information. lespinosa@imim.es Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer mulero-2013-2 Chromatin-Bound IKBA Regulates a Subset of Polycomb Target Genes in Differentiation and Cancer. human-keratinocyte Homo sapiens keratinocyte Keratinocyte ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Mulero M.C., Ferres-Marco D., Islam A., Margalef P., Pecoraro M., Toll A., Drechsel N., Charneco C., Davis S., Bellora N., Gallardo F., Lopez-Arribillaga E., Asensio-Juan E., Rodilla V., Gonzalez J., Iglesias M., Shih V., Mar Alba  M., Di Croce L., Hoffmann A., Miyamoto S., Villa -Freixa J., Lopez-Bigas N., Keyes W.M., Dominguez M., Bigas A., Espinosa L. Chromatin - Epigenetic interactions resulting in chromatin modulation The origin of the HA-IkBa and mutants, Histone H2 extract, plus other constructs, notably -His-SUMOs, GST-IKBA, HA-SUZ12, HA-IKBA (delta 55-102) and GST-H4 could not be found in the references given, references quoted therein and previous work by principal authors. The authors did not respond to a request for information. lespinosa@imim.es Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer mulero-2013-3 Chromatin-Bound IKBA Regulates a Subset of Polycomb Target Genes in Differentiation and Cancer. mouse-keratinocyte Mouse Keratinocyte keratinocyte Keratinocyte anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mulero M.C., Ferres-Marco D., Islam A., Margalef P., Pecoraro M., Toll A., Drechsel N., Charneco C., Davis S., Bellora N., Gallardo F., Lopez-Arribillaga E., Asensio-Juan E., Rodilla V., Gonzalez J., Iglesias M., Shih V., Mar Alba  M., Di Croce L., Hoffmann A., Miyamoto S., Villa -Freixa J., Lopez-Bigas N., Keyes W.M., Dominguez M., Bigas A., Espinosa L. Chromatin - Epigenetic interactions resulting in chromatin modulation The origin of the HA-IkBa and mutants, Histone H2 extract, plus other constructs, notably -His-SUMOs, GST-IKBA, HA-SUZ12, HA-IKBA (delta 55-102) and GST-H4 could not be found in the references given, references quoted therein and previous work by principal authors. The authors did not respond to a request for information. lespinosa@imim.es Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer mulero-2013-7 Chromatin-Bound IKBA Regulates a Subset of Polycomb Target Genes in Differentiation and Cancer. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Mulero M.C., Ferres-Marco D., Islam A., Margalef P., Pecoraro M., Toll A., Drechsel N., Charneco C., Davis S., Bellora N., Gallardo F., Lopez-Arribillaga E., Asensio-Juan E., Rodilla V., Gonzalez J., Iglesias M., Shih V., Mar Alba  M., Di Croce L., Hoffmann A., Miyamoto S., Villa -Freixa J., Lopez-Bigas N., Keyes W.M., Dominguez M., Bigas A., Espinosa L. Chromatin - Epigenetic interactions resulting in chromatin modulation The origin of the HA-IkBa and mutants, Histone H2 extract, plus other constructs, notably -His-SUMOs, GST-IKBA, HA-SUZ12, HA-IKBA (delta 55-102) and GST-H4 could not be found in the references given, references quoted therein and previous work by principal authors. The authors did not respond to a request for information. lespinosa@imim.es Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer mulero-2013-1 Chromatin-Bound IKBA Regulates a Subset of Polycomb Target Genes in Differentiation and Cancer. human-keratinocyte Homo sapiens keratinocyte Keratinocyte anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mulero M.C., Ferres-Marco D., Islam A., Margalef P., Pecoraro M., Toll A., Drechsel N., Charneco C., Davis S., Bellora N., Gallardo F., Lopez-Arribillaga E., Asensio-Juan E., Rodilla V., Gonzalez J., Iglesias M., Shih V., Mar Alba  M., Di Croce L., Hoffmann A., Miyamoto S., Villa -Freixa J., Lopez-Bigas N., Keyes W.M., Dominguez M., Bigas A., Espinosa L. Chromatin - Epigenetic interactions resulting in chromatin modulation The origin of the HA-IkBa and mutants, Histone H2 extract, plus other constructs, notably -His-SUMOs, GST-IKBA, HA-SUZ12, HA-IKBA (delta 55-102) and GST-H4 could not be found in the references given, references quoted therein and previous work by principal authors. The authors did not respond to a request for information. lespinosa@imim.es Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer mulero-2013-6 Chromatin-Bound IKBA Regulates a Subset of Polycomb Target Genes in Differentiation and Cancer. drome-salivary_gland Drosophila melanogaster Salivary gland salivary_gland Salivary gland fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Mulero M.C., Ferres-Marco D., Islam A., Margalef P., Pecoraro M., Toll A., Drechsel N., Charneco C., Davis S., Bellora N., Gallardo F., Lopez-Arribillaga E., Asensio-Juan E., Rodilla V., Gonzalez J., Iglesias M., Shih V., Mar Alba  M., Di Croce L., Hoffmann A., Miyamoto S., Villa -Freixa J., Lopez-Bigas N., Keyes W.M., Dominguez M., Bigas A., Espinosa L. Chromatin - Epigenetic interactions resulting in chromatin modulation Polytene chromosomes from third instar larvae. The origin of the HA-IkBa and mutants, Histone H2 extract, plus other constructs, notably -His-SUMOs, GST-IKBA, HA-SUZ12, HA-IKBA (delta 55-102) and GST-H4 could not be found in the references given, references quoted therein and previous work by principal authors. The authors did not respond to a request for information. lespinosa@imim.es Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer hxa10_mouse_gene HXA10_MOUSE_GENE/HOXA10 gene gene mouse Mus musculus Mouse suz12_mouse Polycomb protein Suz12 Suz12 D11Ertd530e Kiaa0160 Suppressor of zeste 12 protein homolog protein protein mouse Mus musculus Mouse MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAAVAAAASGGKSGGGGCGGGGSYSASSSSAAAAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTSIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSQNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVSEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPVAKPLATRNSESLHQENKPGSVKPAQTIAVKETLTTELQTRKEKDNSNESRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESATPSNEEIAEEQNGTANGFSETNSKEKALETDGVSGVPKQSKKQKL foxd2_mouse_gene FOXD2_MOUSE_GENE gene gene mouse Mus musculus Mouse irx3_mouse_gene IRX3_MOUSE_GENE gene gene mouse Mus musculus Mouse hbx2_mouse_gene HXB2_MOUSE_GENE/HOXB2 gene gene mouse Mus musculus Mouse kdm5b_mouse_gene KDM5B_MOUSE_GENE gene gene mouse Mus musculus Mouse ezh2_mouse Histone-lysine N-methyltransferase EZH2 Ezh2 Enx1h Enhancer of zeste homolog 2 ENX-1 protein protein mouse Mus musculus Mouse MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKTMFSSNRQKILERTETLNQEWKQRRIQPVHIMTSVSSLRGTRECSVTSDLDFPAQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPDEREEKQKDLEDNRDDKETCPPRKFPADKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTISVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPVPTEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP hxb8_mouse_gene HXB8_MOUSE_GENE gene gene mouse Mus musculus Mouse hxb5_mouse_gene HXB5_MOUSE_GENE gene gene mouse Mus musculus Mouse hxd1_mouse_gene HXD1_MOUSE_MOUSE/HOXD1 gene gene mouse Mus musculus Mouse pax6_mouse_gene PAX6_MOUSE_GENE gene gene mouse Mus musculus Mouse tf65_mouse Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit Rela Nfkb3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein mouse Mus musculus Mouse MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPTRNSTSVPKPAPQPYTFPASLSTINFDEFSPMLLPSGQISNQALALAPSSAPVLAQTMVPSSAMVPLAQPPAPAPVLTPGPPQSLSAPVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQGVSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFSSIADMDFSALLSQISS ikba_mouse_gene IKBA_MOUSE_GENE gene gene mouse Mus musculus Mouse ikba_mouse NF-kappa-B inhibitor alpha I-kappa-B-alpha Nfkbia Ikba protein protein mouse Mus musculus Mouse MFQPAGHGQDWAMEGPRDGLKKERLVDDRHDSGLDSMKDEEYEQMVKELREIRLQPQEAPLAAEPWKQQLTEDGDSFLHLAIIHEEKPLTMEVIGQVKGDLAFLNFQNNLQQTPLHLAVITNQPGIAEALLKAGCDPELRDFRGNTPLHLACEQGCLASVAVLTQTCTPQHLHSVLQATNYNGHTCLHLASIHGYLAIVEHLVTLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDELPYDDCVFGGQRLTL ikba_human NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 protein protein human Homo sapiens Human MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL irx3_human_gene IRX3_HUMAN_GENE gene gene human Homo sapiens Human hxa10_human_gene HOXA10 Human Gene gene gene human Homo sapiens Human hxb2_human_gene HXB2_HUMAN_GENE/HOXB2 gene gene human Homo sapiens Human hbx5_human_gene HXB5_HUMAN_GENE/HOXB5 gene gene human Homo sapiens Human hxd3_human_gene HXD3_HUMAN_GENE gene gene human Homo sapiens Human h4_mouse Histone H4 H4c11 H4c12 H4c14 H4c2 H4c3 H4c4 H4c6 H4c8 H4c9 H4f16 Hist1h4a Hist4h4 Hist1h4b Hist1h4c Hist1h4d Hist1h4f Hist1h4h Hist1h4i Hist1h4j Hist1h4k Hist2h4a Hist2h4 Hist1h4m H4-53 H4-12 H4c1 protein protein mouse Mus musculus Mouse MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG cact_drome NF-kappa-B inhibitor cactus CG5848 cact protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPSPTKAAEAATKATATSDCSCSAASVEQRAPSNAANPSSSLATSGKIGGKTQDQTAAINKQKEFAVPNETSDSGFISGPQSSQIFSEEIVPDSEEQDKDQQESAPQKEQPVVLDSGIIDEEEDQEEQEKEEEHQDTTTATADSMRLKHSADTGIPQWTVESHLVSRGEQLNNLGQSSSTQITGRSKVQSSTASTANANPSGSGATSSAPPSSINIMNAWEQFYQQNDDGDTPLHLACISGSVDVVAALIRMAPHPCLLNIQNDVAQTPLHLAALTAQPNIMRILLLAGAEPTVRDRHGNTALHLSCIAGEKQCVRALTEKFGATEIHEAHRQYGHRSNDKAVSSLSYACLPADLEIRNYDGERCVHLAAEAGHIDILRILVSHGADINAREGKSGRTPLHIAIEGCNEDLANFLLDECEKLNLETATYAGLTAYQFACIMNKSRMQNILEKRGAETVTPPDSDYDSSDIEDLDDTKMYDRFGDPRYFVSYNGGNPMTVA tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS pc_drome Polycomb group protein Pc Pc CG7618 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTGRGKGSKGKLGRDNATDDPVDLVYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNKSSGTPSKRGIKKKEKEPDPEPESEEDEYTFTENDVDTHQATTSSATHDKESKKEKKHHHHHHHHHHIKSERNSGRRSESPLTHHHHHHHHESKRQRIDHSSSSNSSFTHNSFVPEPDSNSSSSEDQPLIGTKRKAEVLKESGKIGVTIKTSPDGPTIKPQPTQQVTPSQQQPFQDQQQAEKIASEAATQLKSEQQATPLATEAINTTPAESGAEEEEVANEEGNQQAPQVPSENNNIPKPCNNLAINQKQPLTPLSPRALPPRFWLPAKCNISNRVVITDVTVNLETVTIRECKTERGFFRERDMKGDSSPVA suz12-hx10 1434153 n/a 1434160 unspecified role unspecified role prey prey n/a 1434161 unspecified role unspecified role bait bait association association false false false 4C TNFalpha suz12-hxa10 1434153 n/a 1434161 unspecified role unspecified role bait bait n/a 1434162 unspecified role unspecified role prey prey association association false false false 4Ci TNFalpha suz12-hbx2 1434153 n/a 1434163 unspecified role unspecified role prey prey n/a 1434161 unspecified role unspecified role bait bait association association false false false 4Cii TNFalpha suz12-hbx2-1 1434153 n/a 1434161 unspecified role unspecified role bait bait n/a 1434164 unspecified role unspecified role prey prey association association false false false 4Ciii TNFalpha suz12-foxd2 1434153 n/a 1434161 unspecified role unspecified role bait bait n/a 1434165 unspecified role unspecified role prey prey association association false false false 4Civ TNFalpha suz12-kdm5b 1434153 n/a 1434165 unspecified role unspecified role prey prey n/a 1434161 unspecified role unspecified role bait bait association association false false false 4Cv TNFalpha ezh2-hxb8 1434153 n/a 1434166 unspecified role unspecified role bait bait n/a 1434167 unspecified role unspecified role prey prey association association false false false 6Bi Binding of SUZ12 and EZH2 at IkBa targets was significantly decreased in mutant H-RasV12 plus delta-Np63a transduced cells. ezh2-hxb8-1 1434153 n/a 1434166 unspecified role unspecified role bait bait n/a 1434168 unspecified role unspecified role prey prey association association false false false 6Bii Binding of SUZ12 and EZH2 at IkBa targets was significantly decreased in mutant H-RasV12 plus delta-Np63a transduced cells. ezh2-hxb5 1434153 n/a 1434166 unspecified role unspecified role bait bait n/a 1434169 unspecified role unspecified role prey prey association association false false false 6Biii Binding of SUZ12 and EZH2 at IkBa targets was significantly decreased in mutant H-RasV12 plus delta-Np63a transduced cells. ezh2-hxd1-2 1434153 n/a 1434169 unspecified role unspecified role prey prey n/a 1434161 unspecified role unspecified role bait bait association association false false false 6Biv Binding of SUZ12 and EZH2 at IkBa targets was significantly decreased in mutant H-RasV12 plus delta-Np63a transduced cells. ezh2-hxb8-2 1434153 n/a 1434167 unspecified role unspecified role prey prey n/a 1434161 unspecified role unspecified role bait bait association association false false false 6Bv Binding of SUZ12 and EZH2 at IkBa targets was significantly decreased in mutant H-RasV12 plus delta-Np63a transduced cells. ezh2-hxb5-1 1434153 n/a 1434168 unspecified role unspecified role prey prey n/a 1434161 unspecified role unspecified role bait bait association association false false false 6Bvi Binding of SUZ12 and EZH2 at IkBa targets was significantly decreased in mutant H-RasV12 plus delta-Np63a transduced cells. suz12-hxa10-1 1434153 n/a 1434170 unspecified role unspecified role prey prey n/a 1434161 unspecified role unspecified role bait bait association association false false false 4C TNFalpha rela-ikba 1434153 n/a 1434171 unspecified role unspecified role bait bait n/a 1434172 unspecified role unspecified role prey prey association association false false false Supp 3E It is unclear from the figure legend if this Chip was carried out in Human or Mouse keratinocytes - entered as Mouse on the basis of info given in the main text. suz12-hxd1 1434154 n/a 1434169 unspecified role unspecified role prey prey n/a 1434161 unspecified role unspecified role bait bait association association false false false 4Fi TNFalpha SUZ12 and EZH2 bound targets in WT MEFs but only weakly in IKBa KO MEFs. TNF-alpha treatment induced a significant but temporary release of SUZ12 and EZH2 (reduction in binding) , which peaked after 30 to 60 min of treatment. suz12-hxb5 1434154 n/a 1434161 unspecified role unspecified role bait bait n/a 1434168 unspecified role unspecified role prey prey association association false false false 4Fii TNFalpha SUZ12 and EZH2 bound targets in WT MEFs but only weakly in IKBa KO MEFs. TNF-alpha treatment induced a significant but temporary release of SUZ12 and EZH2 (reduction in binding) , which peaked after 30–60 min of treatment. suz12-hxb8 1434154 n/a 1434167 unspecified role unspecified role prey prey n/a 1434161 unspecified role unspecified role bait bait association association false false false 4Fiii TNFalpha SUZ12 and EZH2 bound targets in WT MEFs but only weakly in IKBa KO MEFs. TNF-alpha treatment induced a significant but temporary release of SUZ12 and EZH2 (reduction in binding) , which peaked after 30–60 min of treatment. ezh2-hxd1-1 1434154 n/a 1434166 unspecified role unspecified role bait bait n/a 1434169 unspecified role unspecified role prey prey association association false false false 4Fiv TNFalpha SUZ12 and EZH2 bound targets in WT MEFs but only weakly in IKBa KO MEFs. TNF-alpha treatment induced a significant but temporary release of SUZ12 and EZH2 (reduction in binding) , which peaked after 30–60 min of treatment. suz12-hxb5-1 1434154 n/a 1434168 unspecified role unspecified role prey prey n/a 1434166 unspecified role unspecified role bait bait association association false false false 4Fv TNFalpha SUZ12 and EZH2 bound targets in WT MEFs but only weakly in IKBa KO MEFs. TNF-alpha treatment induced a significant but temporary release of SUZ12 and EZH2 (reduction in binding) , which peaked after 30–60 min of treatment. suz12-hxb8-1 1434154 n/a 1434166 unspecified role unspecified role bait bait n/a 1434167 unspecified role unspecified role prey prey association association false false false 4Fvi TNFalpha SUZ12 and EZH2 bound targets in WT MEFs but only weakly in IKBa KO MEFs. TNF-alpha treatment induced a significant but temporary release of SUZ12 and EZH2 (reduction in binding) , which peaked after 30–60 min of treatment. suz12-hxd1-1 1434154 n/a 1434169 unspecified role unspecified role prey prey n/a 1434173 unspecified role unspecified role bait bait association association false false false 4Fvii TNFalpha IKBA binding to all loci occurred in WT MEFs but only weakly in IKBa KO MEFs. TNF-alpha treatment induced a significant but temporary release of SUZ12 and EZH2 (reduction in binding) , which peaked after 30 to 60 min of treatment. suz12-hxb5-2 1434154 n/a 1434173 unspecified role unspecified role bait bait n/a 1434168 unspecified role unspecified role prey prey association association false false false 4Fviii TNFalpha IKBA binding to all loci occurred in WT MEFs but only weakly in IKBa KO MEFs. TNF-alpha treatment induced a significant but temporary release of SUZ12 and EZH2 (reduction in binding) , which peaked after 30 to 60 min of treatment. suz12-hxb8-2 1434154 n/a 1434173 unspecified role unspecified role bait bait n/a 1434167 unspecified role unspecified role prey prey association association false false false 4Fix TNFalpha IKBA binding to all loci occurred in WT MEFs but only weakly in IKBa KO MEFs. TNF-alpha treatment induced a significant but temporary release of SUZ12 and EZH2 (reduction in binding) , which peaked after 30 to 60 min of treatment. nfkbia-rela-7 1434155 n/a 1434174 unspecified role unspecified role bait bait n/a 1434175 unspecified role unspecified role prey prey possible_enhancer_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 3D/E Calcium, TNFa nfkbia-hxa10 1434155 n/a 1434174 unspecified role unspecified role bait bait n/a 1434176 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 3D/Ei Calcium, TNFa nfkbia-irx3 1434155 n/a 1434177 unspecified role unspecified role prey prey possible_enhancer_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1434174 unspecified role unspecified role bait bait association association false false false 3D/E Calcium, TNFa nfkbia-hxb2 1434155 n/a 1434178 unspecified role unspecified role prey prey downstream_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1434174 unspecified role unspecified role bait bait association association false false false 3D nfkbia-hbx5 1434155 n/a 1434174 unspecified role unspecified role bait bait n/a 1434179 unspecified role unspecified role prey prey unknown_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 3Di nfkbia-suz12 1434156 n/a 1434161 unspecified role unspecified role prey prey n/a 1434173 unspecified role unspecified role bait bait physical association physical association false false false 4A nfkbia-suz12-1 1434156 n/a 1434171 unspecified role unspecified role prey prey n/a 1434173 unspecified role unspecified role bait bait physical association physical association false false false 4Ai hist1h4h-nfkbia 1434157 n/a 1434173 unspecified role unspecified role prey prey possible_phospho_res phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false possible_sumo_res sumoylated lysine sumoylated lysine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mouse-keratinocyte Mouse Keratinocyte keratinocyte Keratinocyte n/a 1434180 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Supp 2B cact-rela 1434157 n/a 1434181 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1434182 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false 5A nfkbia-rela-6 1434158 n/a 1434182 unspecified role unspecified role prey prey n/a 1434174 unspecified role unspecified role bait bait physical association physical association false false false 2C cact-pc 1434159 n/a 1434183 unspecified role unspecified role neutral component neutral component n/a 1434181 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 5B