IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lamy-2013-1 Control of autophagic cell death by caspase-10 in multiple myeloma. human-kms12 KMS12 Myeloma cell line kms12 KMS12 Myeloma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lamy L., Ngo V.N., Emre N.C., Shaffer A.L., Yang Y., Tian E., Nair V., Kruhlak M.J., Zingone A., Landgren O., Staudt L.M. Cancer - Interactions investigated in the context of cancer Several experiments in this publication use the cell line "KMS12". The authors have not replied to requests for clarification as to whether this cell line is KMS12-PE or KMS12-BM. lstaudt@mail.nih.gov Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation lamy-2013-2 Control of autophagic cell death by caspase-10 in multiple myeloma. human-skmm1 SK-MM-1 skmm1 SK-MM-1 Myeloma cell line pull down pull down western blot western blot Immuno blot Immuno blot Lamy L., Ngo V.N., Emre N.C., Shaffer A.L., Yang Y., Tian E., Nair V., Kruhlak M.J., Zingone A., Landgren O., Staudt L.M. Cancer - Interactions investigated in the context of cancer Several experiments in this publication use the cell line "KMS12". The authors have not replied to requests for clarification as to whether this cell line is KMS12-PE or KMS12-BM. The "protease-dead version of the caspase-10 D isoform in which the catalytic site cysteine was replaced by serine. " has been entered as cys401ser. However no reply was received from the authors to confirm this is the correct mutation. The TAP-Caspase 10* isoform D construct carries mutations in the shCasp10-1 target sequence. These mutations are stated to be silent ( see Supplemental Experimental Procedures -Molecular biology). The Tap tag consists of a C terminal streptavidin binding protein and calmodulin binding protein, according to the Agilent/Stratagene web site. lstaudt@mail.nih.gov Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation lamy-2013-4 Control of autophagic cell death by caspase-10 in multiple myeloma. human-skmm1 SK-MM-1 skmm1 SK-MM-1 Myeloma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lamy L., Ngo V.N., Emre N.C., Shaffer A.L., Yang Y., Tian E., Nair V., Kruhlak M.J., Zingone A., Landgren O., Staudt L.M. Cancer - Interactions investigated in the context of cancer Several experiments in this publication use the cell line "KMS12". The authors have not replied to requests for clarification as to whether this cell line is KMS12-PE or KMS12-BM. lstaudt@mail.nih.gov Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation lamy-2013-5 Control of autophagic cell death by caspase-10 in multiple myeloma. human-kms12 KMS12 Myeloma cell line kms12 KMS12 Myeloma cell line ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lamy L., Ngo V.N., Emre N.C., Shaffer A.L., Yang Y., Tian E., Nair V., Kruhlak M.J., Zingone A., Landgren O., Staudt L.M. Cancer - Interactions investigated in the context of cancer Several experiments in this publication use the cell line "KMS12". The authors have not replied to requests for clarification as to whether this cell line is KMS12-PE or KMS12-BM. lstaudt@mail.nih.gov Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation lamy-2013-6 Control of autophagic cell death by caspase-10 in multiple myeloma. human-kms12 KMS12 Myeloma cell line kms12 KMS12 Myeloma cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Lamy L., Ngo V.N., Emre N.C., Shaffer A.L., Yang Y., Tian E., Nair V., Kruhlak M.J., Zingone A., Landgren O., Staudt L.M. Cancer - Interactions investigated in the context of cancer Several experiments in this publication use the cell line "KMS12". The authors have not replied to requests for clarification as to whether this cell line is KMS12-PE or KMS12-BM. lstaudt@mail.nih.gov Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation lamy-2013-7 Control of autophagic cell death by caspase-10 in multiple myeloma. human-utmc2 Human Utmc2 monoclonal plasma cell line utmc2 UTMC2 monoclonal plasma cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Lamy L., Ngo V.N., Emre N.C., Shaffer A.L., Yang Y., Tian E., Nair V., Kruhlak M.J., Zingone A., Landgren O., Staudt L.M. Cancer - Interactions investigated in the context of cancer Several experiments in this publication use the cell line "KMS12". The authors have not replied to requests for clarification as to whether this cell line is KMS12-PE or KMS12-BM. lstaudt@mail.nih.gov Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation lamy-2013-3 Control of autophagic cell death by caspase-10 in multiple myeloma. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lamy L., Ngo V.N., Emre N.C., Shaffer A.L., Yang Y., Tian E., Nair V., Kruhlak M.J., Zingone A., Landgren O., Staudt L.M. Cancer - Interactions investigated in the context of cancer Several experiments in this publication use the cell line "KMS12". The authors have not replied to requests for clarification as to whether this cell line is KMS12-PE or KMS12-BM. The TAP-Caspase 10* isoform D construct carries mutations in the shCasp10-1 target sequence. These mutations are stated to be silent. The Tap tag consists of a C terminal streptavidin binding protein and calmodulin binding protein, according to the Agilent/Stratagene web site. lstaudt@mail.nih.gov Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation caspa_human Caspase-10 ICE-like apoptotic protease 4 Apoptotic protease Mch-4 FAS-associated death domain protein interleukin-1B-converting enzyme 2 CASP10 MCH4 protein protein human Homo sapiens Human MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQRVSLFRNLLYELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEKQGKIDEDNLTCLEDLCKTVVPKLLRNIEKYKREKAIQIVTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRMLKFLEKTMEIRGRKRTVWGAKQISATSLPTAISAQTPRPPMRRWSSVS cflar_human CASP8 and FADD-like apoptosis regulator Cellular FLICE-like inhibitory protein Caspase-eight-related protein Caspase-like apoptosis regulatory protein MACH-related inducer of toxicity Caspase homolog Inhibitor of FLICE FADD-like antiapoptotic molecule 1 Usurpin CFLAR CASH CLARP MRIT CASP8AP1 protein protein human Homo sapiens Human MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT o15519-1 CASP8 and FADD-like apoptosis regulator FLIP-L CLARP1 MRIT alpha-1 CASH alpha I-FLICE 1 FLAME-1 gamma Usurpin alpha CFLAR CASH CASP8AP1 CLARP MRIT Caspase homolog Caspase-eight-related protein Caspase-like apoptosis regulatory protein Cellular FLICE-like inhibitory protein FADD-like antiapoptotic molecule 1 Inhibitor of FLICE MACH-related inducer of toxicity Usurpin protein protein human Homo sapiens Human MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK becn1_human Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Protein GT197 BECN1 GT197 protein protein human Homo sapiens Human MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK o15519-pro_0000004678 CASP8 and FADD-like apoptosis regulator subunit p43 CFLAR CASH CASP8AP1 CLARP MRIT Caspase homolog Caspase-eight-related protein Caspase-like apoptosis regulatory protein Cellular FLICE-like inhibitory protein FADD-like antiapoptotic molecule 1 Inhibitor of FLICE MACH-related inducer of toxicity Usurpin protein protein human Homo sapiens Human MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVD 1 376 q92851-4 Caspase-10 10-D 10-L CASP10 MCH4 Apoptotic protease Mch-4 FAS-associated death domain protein interleukin-1B-converting enzyme 2 ICE-like apoptotic protease 4 protein protein human Homo sapiens Human MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQRVSLFRNLLYELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEKQGKIDEDNLTCLEDLCKTVVPKLLRNIEKYKREKAIQIVTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRHEDILSILTAVNDDVSRRVDKQGTKKQMPQPAFTLRKKLVFPVPLDALSL Variant in position: 522:L->I (not associated with significantly altered cutaneous melanoma risk, dbSNP:rs13006529). bclf1_human Bcl-2-associated transcription factor 1 BCLAF1 and THRAP3 family member 1 BCLAF1 BTF KIAA0164 protein protein human Homo sapiens Human MGRSNSRSHSSRSKSRSQSSSRSRSRSHSRKKRYSSRSRSRTYSRSRSRDRMYSRDYRRDYRNNRGMRRPYGYRGRGRGYYQGGGGRYHRGGYRPVWNRRHSRSPRRGRSRSRSPKRRSVSSQRSRSRSRRSYRSSRSPRSSSSRSSSPYSKSPVSKRRGSQEKQTKKAEGEPQEESPLKSKSQEEPKDTFEHDPSESIDEFNKSSATSGDIWPGLSAYDNSPRSPHSPSPIATPPSQSSSCSDAPMLSTVHSAKNTPSQHSHSIQHSPERSGSGSVGNGSSRYSPSQNSPIHHIPSRRSPAKTIAPQNAPRDESRGRSSFYPDGGDQETAKTGKFLKRFTDEESRVFLLDRGNTRDKEASKEKGSEKGRAEGEWEDQEALDYFSDKESGKQKFNDSEGDDTEETEDYRQFRKSVLADQGKSFATASHRNTEEEGLKYKSKVSLKGNRESDGFREEKNYKLKETGYVVERPSTTKDKHKEEDKNSERITVKKETQSPEQVKSEKLKDLFDYSPPLHKNLDAREKSTFREESPLRIKMIASDSHRPEVKLKMAPVPLDDSNRPASLTKDRLLASTLVHSVKKEQEFRSIFDHIKLPQASKSTSESFIQHIVSLVHHVKEQYFKSAAMTLNERFTSYQKATEEHSTRQKSPEIHRRIDISPSTLRKHTRLAGEERVFKEENQKGDKKLRCDSADLRHDIDRRRKERSKERGDSKGSRESSGSRKQEKTPKDYKEYKSYKDDSKHKREQDHSRSSSSSASPSSPSSREEKESKKEREEEFKTHHEMKEYSGFAGVSRPRGTFFRIRGRGRARGVFAGTNTGPNNSNTTFQKRPKEEEWDPEYTPKSKKYFLHDDRDDGVDYWAKRGRGRGTFQRGRGRFNFKKSGSSPKWTHDKYQGDGIVEDEEETMENNEEKKDRRKEEKE irf4_human Interferon regulatory factor 4 Lymphocyte-specific interferon regulatory factor NF-EM5 Multiple myeloma oncogene 1 IRF4 MUM1 protein protein human Homo sapiens Human MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRDYVPDQPHPEIPYQCPMTFGPRGHHWQGPACENGCQVTGTFYACAPPESQAPGVPTEPSIRSAEALAFSDCRLHICLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLFPYPEDNGQRKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE caspa_human_gene Human CASPASE 10 gene gene gene human Homo sapiens Human cflar_human_gene CASP8 and FADD-like apoptosis regulator gene gene gene human Homo sapiens Human cflar-casp10 1383876 n/a 1383883 unspecified role unspecified role prey prey n/a 1383884 unspecified role unspecified role bait bait physical association physical association false false false 4F casp10-cflar-1 1383876 n/a 1383885 unspecified role unspecified role prey prey n/a 1383883 unspecified role unspecified role bait bait physical association physical association false false false 4F-2 bcl2-becn1-3 1383876 n/a 1383886 unspecified role unspecified role bait bait n/a 1383887 unspecified role unspecified role prey prey physical association physical association false false false 6E Q-VD-OPH -a pan-caspase inhibitor. casp10-cflar-3 1383877 n/a 1383888 unspecified role unspecified role prey prey n/a 1383885 unspecified role unspecified role prey prey n/a 1383889 unspecified role unspecified role bait bait c_terminus cam tag calmodulin binding protein tag cam tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q92851-4:p.Cys401Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false c_terminus sbp sbp c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false 4G Protease-dead TAP-Casp10* associated with full-length cFLIPL as well as with p43FLIP. casp10-cflar-4 1383877 n/a 1383888 unspecified role unspecified role prey prey n/a 1383889 unspecified role unspecified role bait bait c_terminus cam tag calmodulin binding protein tag cam tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminus sbp sbp c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 4G-a Protease-dead TAP-Casp10* associated with full-length cFLIPL as well as with p43FLIP wheras the wild type only appeared to associate with the p43 form. casp10-cflar-7 1383877 n/a 1383889 unspecified role unspecified role bait bait Q92851-4:p.Cys401Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false c_terminus sbp sbp c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminus cam tag calmodulin binding protein tag cam tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1383890 unspecified role unspecified role prey prey physical association physical association false false false Supp 5E Full-length BCLAF1 readily coimmunoprecipitated with the proteolytically dead mutant TAP-Casp10∗ isoform D. casp10-cflar-6 1383878 n/a 1383883 unspecified role unspecified role bait bait n/a 1383890 unspecified role unspecified role prey prey physical association physical association false false false 5D bcl2-bclaf1 1383878 n/a 1383887 unspecified role unspecified role prey prey n/a 1383886 unspecified role unspecified role bait bait n/a 1383890 unspecified role unspecified role prey prey association association false false false 6G. Q-VD-OPH -a pan-caspase inhibitor. When BCLAF1-DHFR (a fusion of BCLAF1 to an 18 kDa dihydrofolate reductase (DHFR)-derived “destruction” domain) was transduced the amount of beclin-1 that could be coimmunoprecipitated with BCL-2 decreased. bcl2-bclaf1-1 1383878 n/a 1383886 unspecified role unspecified role bait bait n/a 1383890 unspecified role unspecified role prey prey physical association physical association false false false 6F Q-VD-OPH -a pan-caspase inhibitor. Caspase inhibition strongly increased this interaction. irf4-caspa 1383879 n/a 1383891 unspecified role unspecified role bait bait n/a 1383892 unspecified role unspecified role prey prey association association false false false Supp 4B Three peaks were seen for IRF4 binding; one near the Caspase10 gene TSS, and the other two in the body of the gene. Peaks were centered over repeats of an IRF4 DNA binding motif (GAAA or TTTC). irf4-caspa-3 1383879 n/a 1383893 unspecified role unspecified role prey prey n/a 1383891 unspecified role unspecified role bait bait association association false false false Supp 4D IRF4 binds to a promoter-proximal region in the CFLAR first intron. irf4-caspa-1 1383880 n/a 1383892 unspecified role unspecified role prey prey n/a 1383891 unspecified role unspecified role bait bait association association false false false Supp 4C Primer pairs were derived from peak 1 (near to TSS) in the CASP10 locus from the ChIp-seq experiment. irf4-cflar 1383880 n/a 1383891 unspecified role unspecified role bait bait n/a 1383893 unspecified role unspecified role prey prey association association false false false Supp 4E IRF4 binds to a promoter-proximal region in the CFLAR first intron. irf4-caspa-2 1383881 n/a 1383892 unspecified role unspecified role prey prey n/a 1383891 unspecified role unspecified role bait bait association association false false false Supp 4C Primer pairs were derived from peak 1 (near to TSS) in the CASP10 locus from the ChIp-seq experiment. irf4-cflar-1 1383881 n/a 1383891 unspecified role unspecified role bait bait n/a 1383893 unspecified role unspecified role prey prey association association false false false Supp 4E-2 IRF4 binds to a promoter-proximal region in the CFLAR first intron. casp10-cflar-5 1383882 n/a 1383889 unspecified role unspecified role bait bait c_terminus sbp sbp c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminus cam tag calmodulin binding protein tag cam tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 1383885 unspecified role unspecified role prey prey human-skmm1 SK-MM-1 skmm1 SK-MM-1 Myeloma cell line n/a 1383888 unspecified role unspecified role prey prey human-skmm1 SK-MM-1 skmm1 SK-MM-1 Myeloma cell line association association false false false 4H,I Incubation of TAP-Casp10∗ with the SKMM1 extract gave a small amount of a cleaved ∼47 kDa TAP-Casp10∗ fragment. Warming to 37°C for 10 min significantly increased this cleavage of caspase-10 and the processing of cFLIPL into p43FLIP. The TAP-Caspase 10* isoform D construct carries mutations in the shCasp10-1 target sequence. These mutations are stated to be silent ( see Supplemental Experimental Procedures -Molecular biology).