IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ anonymous-2013c-4 The E3 ubiquitin ligase Siah2 contributes to castration-resistant prostate cancer by regulation of androgen receptor transcriptional activity. human-cwr22rv1 Homo sapiens cwr22rv1 Androgen-responsive human prostate carcinoma cell line CWR22Rv1 ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Qi J., Tripathi M., Mishra R., Sahgal N., Fazil L., Ettinger S., Placzek W.J., Claps G., Chung L.W., Bowtell D., Gleave M., Bhowmick N., Ronai Z.A. Cancer - Interactions investigated in the context of cancer The authors confirm that GST-Siah2, as used in figure 4E, is of Murine origin. jfqi@sbmri.org, ronai@sbmri.org Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation anonymous-2013c-5 The E3 ubiquitin ligase Siah2 contributes to castration-resistant prostate cancer by regulation of androgen receptor transcriptional activity. human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Qi J., Tripathi M., Mishra R., Sahgal N., Fazil L., Ettinger S., Placzek W.J., Claps G., Chung L.W., Bowtell D., Gleave M., Bhowmick N., Ronai Z.A. Cancer - Interactions investigated in the context of cancer ChIP assays using acetylated histone H3 antibody have not been included due to lack of antibody specificity. The authors confirm that GST-Siah2, as used in figure 4E, is of Murine origin. jfqi@sbmri.org, ronai@sbmri.org Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation anonymous-2013b-6 The E3 ubiquitin ligase Siah2 contributes to castration-resistant prostate cancer by regulation of androgen receptor transcriptional activity. human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Qi J., Tripathi M., Mishra R., Sahgal N., Fazil L., Ettinger S., Placzek W.J., Claps G., Chung L.W., Bowtell D., Gleave M., Bhowmick N., Ronai Z.A. Cancer - Interactions investigated in the context of cancer chIP-reChIP experiment - the bait of the first round of ChIP becomes a prey for the second IP. The authors confirm that GST-Siah2, as used in figure 4E, is of Murine origin. jfqi@sbmri.org, ronai@sbmri.org Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation anonymous-2013b-1 The E3 ubiquitin ligase Siah2 contributes to castration-resistant prostate cancer by regulation of androgen receptor transcriptional activity. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Qi J., Tripathi M., Mishra R., Sahgal N., Fazil L., Ettinger S., Placzek W.J., Claps G., Chung L.W., Bowtell D., Gleave M., Bhowmick N., Ronai Z.A. Cancer - Interactions investigated in the context of cancer The authors confirm that GST-Siah2, as used in figure 4E, is of Murine origin. jfqi@sbmri.org, ronai@sbmri.org Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation anonymous-2013c-7 The E3 ubiquitin ligase Siah2 contributes to castration-resistant prostate cancer by regulation of androgen receptor transcriptional activity. human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Qi J., Tripathi M., Mishra R., Sahgal N., Fazil L., Ettinger S., Placzek W.J., Claps G., Chung L.W., Bowtell D., Gleave M., Bhowmick N., Ronai Z.A. Cancer - Interactions investigated in the context of cancer The authors confirm that GST-Siah2, as used in figure 4E, is of Murine origin. jfqi@sbmri.org, ronai@sbmri.org Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation anonymous-2013c-2 The E3 ubiquitin ligase Siah2 contributes to castration-resistant prostate cancer by regulation of androgen receptor transcriptional activity. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Qi J., Tripathi M., Mishra R., Sahgal N., Fazil L., Ettinger S., Placzek W.J., Claps G., Chung L.W., Bowtell D., Gleave M., Bhowmick N., Ronai Z.A. Cancer - Interactions investigated in the context of cancer The authors confirm that GST-Siah2, as used in figure 4E, is of Murine origin. jfqi@sbmri.org, ronai@sbmri.org Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation anonymous-2013c-3 The E3 ubiquitin ligase Siah2 contributes to castration-resistant prostate cancer by regulation of androgen receptor transcriptional activity. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Qi J., Tripathi M., Mishra R., Sahgal N., Fazil L., Ettinger S., Placzek W.J., Claps G., Chung L.W., Bowtell D., Gleave M., Bhowmick N., Ronai Z.A. Cancer - Interactions investigated in the context of cancer The authors confirm that GST-Siah2, as used in figure 4E, is of Murine origin. jfqi@sbmri.org, ronai@sbmri.org Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation siah2_human E3 ubiquitin-protein ligase SIAH2 Seven in absentia homolog 2 SIAH2 RING-type E3 ubiquitin transferase SIAH2 protein protein human Homo sapiens Human MSRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGGGGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP klk3_human_gene Human kallikrein-related peptidase 3 (KLK3) (PSA) gene gene human Homo sapiens Human nkx3.1_human_gene NKX31_HUMAN_GENE gene gene human Homo sapiens Human pmepa_human_gene PMEPA_HUMAN_GENE gene gene human Homo sapiens Human andr_human Androgen receptor Dihydrotestosterone receptor Nuclear receptor subfamily 3 group C member 4 AR DHTR NR3C4 protein protein human Homo sapiens Human MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQQQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPYGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ tmps2_human_gene Human TMPS2/TMPRSS2 gene gene gene human Homo sapiens Human ncor1_human Nuclear receptor corepressor 1 NCOR1 KIAA1047 protein protein human Homo sapiens Human MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQRVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDEEEKDEKEDSKENTKEKDKIDGTAEETEEREQATPRGRKTANSQGRRKGRITRSMTNEAAAASAAAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKTSRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEVEAVKPSEDSPENATSRGNTEPAVELEPTTETAPSTSPSLAVPSTKPAEDESVETQVNDSISAETAEQMDVDQQEHSAEEGSVCDPPPATKADSVDVEVRVPENHASKVEGDNTKERDLDRASEKVEPRDEDLVVAQQINAQRPEPQSDNDSSATCSADEDVDGEPERQRMFPMDSKPSLLNPTGSILVSSPLKPNPLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQIDLECRSSTSPCGTSKSPNREWEVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLTSHNQASYTQETPKPSVGSISLGLPRQQESAKSATLPYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAIQEGSITRGTPTSKISVESIPSLRGSITQGTPALPQTGIPTEALVKGSISRMPIEDSSPEKGREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEISLKRSYESVEGNIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATTESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLSRGMPPLEIVPENIKVVERGKYEDVKAGETVRSRHTSVVSSGPSVLRSTLHEAPKAQLSPGIYDDTSARRTPVSYQNTMSRGSPMMNRTSDVTISSNKSTNHERKSTLTPTQRESIPAKSPVPGVDPVVSHSPFDPHHRGSTAGEVYRSHLPTHLDPAMPFHRALDPAAAAYLFQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVARGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHPGGTSTPPMDRITYIPGTQITFPPRPYNSASMSPGHPTHLAAAASAEREREREREKERERERIAAASSDLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETMLQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPAGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKTLEVEKRSVQCLYTSSAFPSGKPQPHSSVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETPSDAIEVISPASSPAPPQEKLQTYQPEVVKANQAENDPTRQYEGPLHHYRPQQESPSPQQQLPPSSQAEGMGQVPRTHRLITLADHICQIITQDFARNQVSSQTPQQPPTSTFQNSPSALVSTPVRTKTSNRYSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHEKQDSLLLLSQRGAEPAEQRNDARSPGSISYLPSFFTKLENTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGSVSSRGHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSQPMGVVPGTANTSVVTSGETRREEGDPSPHSGGVCKPKLISKSNSRKSKSPIPGQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTMRMLSSTPPTPIACAPSAVNQAAPHQQNRIWEREPAPLLSAQYETLSDSDD ibp3_human_gene IBP3_HUMAN_GENE gene gene human Homo sapiens Human ppap_human_gene PPAP_HUMAN_GENE gene gene human Homo sapiens Human kpcd_human_gene KPCD_HUMAN_GENE gene gene human Homo sapiens Human dhso_human_gene DHSO_HUMAN_GENE gene gene human Homo sapiens Human scap_human_gene SCAP_HUMAN_GENE gene gene human Homo sapiens Human stk39_human_gene STK39_HUMAN_GENE gene gene human Homo sapiens Human pde9a_human_gene PDE9A_HUMAN_GENE gene gene human Homo sapiens Human dhc24_human_gene DHC24_HUMAN_GENE gene gene human Homo sapiens Human fxyd3_human_gene FXYD3_HUMAN_GENE gene gene human Homo sapiens Human dopd_human_gene DOPD_HUMAN_GENE gene gene human Homo sapiens Human nep_human_gene NEP_HUMAN_GENE gene gene human Homo sapiens Human stea2_human_gene STEA2_HUMAN_GENE gene gene human Homo sapiens Human ndrg1_human_gene Human NDRG1 gene gene gene human Homo sapiens Human mt1x_human_gene MT1X_HUMAN_GENE gene gene human Homo sapiens Human acbp_human_gene ACBP_HUMAN_GENE gene gene human Homo sapiens Human za2g_human_gene ZA2G_HUMAN_GENE gene gene human Homo sapiens Human ep300_human Histone acetyltransferase p300 Histone butyryltransferase p300 Histone crotonyltransferase p300 Protein propionyltransferase p300 EP300 P300 E1A-associated protein p300 Protein 2-hydroxyisobutyryltransferase p300 Protein lactyltransferas p300 protein protein human Homo sapiens Human MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKAVPGGGMPNMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQPILTGAPVGLGNPSSLGVGQQSAPNLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQNPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSMAQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPSLPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQAIAEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELKTEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHLEPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGISPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPIPGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYPPQQQQRMQHHMQQMQQGNMGQIGQLPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH siah2_mouse E3 ubiquitin-protein ligase SIAH2 Siah2 Seven in absentia homolog 2 RING-type E3 ubiquitin transferase SIAH2 protein protein mouse Mus musculus Mouse MSRPSSTGPSANKPCSKQPPPPQTPHAPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGAGGGADPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCQ siah2-klk3 1382186 n/a 1382193 unspecified role unspecified role bait bait n/a 1382194 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5B Binding of Siah2 to the AREs of PSA, NKX3.1, and PMEPA1 was reduced by knockdown of AR or NCOR1. siah2-klk3-1 1382186 n/a 1382193 unspecified role unspecified role bait bait n/a 1382195 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5B Binding of Siah2 to the AREs of PSA, NKX3.1, and PMEPA1 was reduced by knockdown of AR or NCOR1. siah2-klk3-2 1382186 n/a 1382193 unspecified role unspecified role bait bait n/a 1382196 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5B Binding of Siah2 to the AREs of PSA, NKX3.1, and PMEPA1 was reduced by knockdown of AR or NCOR1. siah2-tmps2 1382186 n/a 1382197 unspecified role unspecified role bait bait n/a 1382198 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5D Binding of AR and NCOR1 to the AREs of PSA, NKX3.1, and PMEPA1 was increased by knockdown of Siah2, but binding to the TMPRSS2 ARE was unaffected. siah2-klk3-6 1382186 n/a 1382194 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382197 unspecified role unspecified role bait bait association association false false false 5Di Binding of AR and NCOR1 to the AREs of PSA, NKX3.1, and PMEPA1 was increased by knockdown of Siah2, but binding to the TMPRSS2 ARE was unaffected. siah2-nkx3_1 1382186 n/a 1382197 unspecified role unspecified role bait bait n/a 1382195 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5Dii Binding of AR and NCOR1 to the AREs of PSA, NKX3.1, and PMEPA1 was increased by knockdown of Siah2, but binding to the TMPRSS2 ARE was unaffected. siah2-pmepa 1382186 n/a 1382197 unspecified role unspecified role bait bait n/a 1382196 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5Diii Binding of AR and NCOR1 to the AREs of PSA, NKX3.1, and PMEPA1 was increased by knockdown of Siah2, but binding to the TMPRSS2 ARE was unaffected. ar-pmepa 1382186 n/a 1382199 unspecified role unspecified role bait bait n/a 1382196 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5Div Binding of AR and NCOR1 to the AREs of PSA, NKX3.1, and PMEPA1 was increased by knockdown of Siah2, but binding to the TMPRSS2 ARE was unaffected. ar-klk3-1 1382186 n/a 1382199 unspecified role unspecified role bait bait n/a 1382194 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5Dv Binding of AR and NCOR1 to the AREs of PSA, NKX3.1, and PMEPA1 was increased by knockdown of Siah2, but binding to the TMPRSS2 ARE was unaffected. ar-nkx3_1 1382186 n/a 1382199 unspecified role unspecified role bait bait n/a 1382195 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5Dvi Binding of AR and NCOR1 to the AREs of PSA, NKX3.1, and PMEPA1 was increased by knockdown of Siah2, but binding to the TMPRSS2 ARE was unaffected. ar-klk3-1 1382186 n/a 1382200 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382197 unspecified role unspecified role bait bait association association false false false Supp 5L-1 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - not including this one. ar-ibp3 1382186 n/a 1382201 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382197 unspecified role unspecified role bait bait association association false false false Supp 5L-2 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-ibp3-1 1382186 n/a 1382197 unspecified role unspecified role bait bait n/a 1382202 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5L-3 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - not including this one. ar-kpcd 1382186 n/a 1382203 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382197 unspecified role unspecified role bait bait association association false false false Supp 5L-4 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-dhso 1382186 n/a 1382204 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382197 unspecified role unspecified role bait bait association association false false false Supp 5L-5 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-scap 1382186 n/a 1382197 unspecified role unspecified role bait bait n/a 1382205 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5L-6 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - not including this one. ar-stk39 1382186 n/a 1382206 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382197 unspecified role unspecified role bait bait association association false false false Supp 5L-7 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-pde9a 1382186 n/a 1382197 unspecified role unspecified role bait bait n/a 1382207 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5L-8 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-dhc24 1382186 n/a 1382197 unspecified role unspecified role bait bait n/a 1382208 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5L-9 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-fxyd3 1382186 n/a 1382209 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382197 unspecified role unspecified role bait bait association association false false false Supp 5L-10 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-dopd 1382186 n/a 1382210 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382197 unspecified role unspecified role bait bait association association false false false Supp 5L-11 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - not including this one. ar-nep 1382186 n/a 1382197 unspecified role unspecified role bait bait n/a 1382211 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5L-12 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-stea2 1382186 n/a 1382197 unspecified role unspecified role bait bait n/a 1382212 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5L-13 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-ndrg1-2 1382186 n/a 1382213 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382197 unspecified role unspecified role bait bait association association false false false Supp 5L-14 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-mt1x 1382186 n/a 1382214 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382197 unspecified role unspecified role bait bait association association false false false Supp 5L-15 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-acbp 1382186 n/a 1382215 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382197 unspecified role unspecified role bait bait association association false false false Supp 5L-16 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - not including this one. ar-ibp3-2 1382186 n/a 1382200 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382199 unspecified role unspecified role bait bait association association false false false Supp 5M-1 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - not including this one. ar-ppap 1382186 n/a 1382201 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382199 unspecified role unspecified role bait bait association association false false false Supp 5M-2 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-kpcd-1 1382186 n/a 1382199 unspecified role unspecified role bait bait n/a 1382202 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5M-3 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - not including this one. ar-dhso-1 1382186 n/a 1382199 unspecified role unspecified role bait bait n/a 1382203 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5M-4 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-scap-1 1382186 n/a 1382199 unspecified role unspecified role bait bait n/a 1382204 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5M-5 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-stk39-1 1382186 n/a 1382199 unspecified role unspecified role bait bait n/a 1382205 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5M-6 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - not including this one. ar-pde9a-1 1382186 n/a 1382199 unspecified role unspecified role bait bait n/a 1382206 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5M-7 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-dhc24-1 1382186 n/a 1382199 unspecified role unspecified role bait bait n/a 1382207 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5M-8 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-fxyd3-1 1382186 n/a 1382199 unspecified role unspecified role bait bait n/a 1382208 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5M-9 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-dopd-1 1382186 n/a 1382209 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382199 unspecified role unspecified role bait bait association association false false false Supp 5M-10 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-nep-1 1382186 n/a 1382199 unspecified role unspecified role bait bait n/a 1382210 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5M-11 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - not including this one. ar-stea2-1 1382186 n/a 1382199 unspecified role unspecified role bait bait n/a 1382211 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5M-12 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-ndrg1-3 1382186 n/a 1382212 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382199 unspecified role unspecified role bait bait association association false false false Supp 5M-13 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-mt1x-1 1382186 n/a 1382199 unspecified role unspecified role bait bait n/a 1382213 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5M-14 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-acbp-1 1382186 n/a 1382214 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382199 unspecified role unspecified role bait bait association association false false false Supp 5M-15 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - including this one. ar-za2g 1382186 n/a 1382199 unspecified role unspecified role bait bait n/a 1382215 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5M-16 Siah2 knockdown increased the levels of AR and NCOR1 bound to 11 of the 16 Siah2-dependent AR targets, - not including this one. ar-ppap-1 1382186 n/a 1382201 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382193 unspecified role unspecified role bait bait association association false false false Supp 5N-2 ar-scap-2 1382186 n/a 1382204 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382193 unspecified role unspecified role bait bait association association false false false Supp 5N-5 ar-pde9a-2 1382186 n/a 1382193 unspecified role unspecified role bait bait n/a 1382206 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5N-7 ar-dhc24-2 1382186 n/a 1382193 unspecified role unspecified role bait bait n/a 1382207 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5N-8 ar-fxyd3-2 1382186 n/a 1382193 unspecified role unspecified role bait bait n/a 1382208 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5N-9 ar-dopd-2 1382186 n/a 1382193 unspecified role unspecified role bait bait n/a 1382209 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5N-10 ar-nep-2 1382186 n/a 1382193 unspecified role unspecified role bait bait n/a 1382210 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp 5N-11 ar-stea2-2 1382186 n/a 1382211 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382193 unspecified role unspecified role bait bait association association false false false Supp 5N-12 ar-ndrg1-4 1382186 n/a 1382212 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382193 unspecified role unspecified role bait bait association association false false false Supp 5N-13 ar-mt1x-2 1382186 n/a 1382213 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382193 unspecified role unspecified role bait bait association association false false false Supp 5N-14 ar-acbp-2 1382186 n/a 1382214 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382193 unspecified role unspecified role bait bait association association false false false Supp 5N-15 siah2-klk3-3 1382187 n/a 1382194 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382193 unspecified role unspecified role bait bait association association false false false 5A R1881 or Metribolone- " the gold standard AR agonist." (Sigma) Binding of Siah2 to the AREs of PSA, NKX3.1, and PMEPA1 was reduced by knockdown of AR or Siah2. siah2-klk3-3 1382187 n/a 1382193 unspecified role unspecified role bait bait n/a 1382195 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5Ai R1881 or Metribolone- " the gold standard AR agonist." (Sigma) Binding of Siah2 to the AREs of PSA, NKX3.1, and PMEPA1 was reduced by knockdown of AR or Siah2. siah2-klk3-3 1382187 n/a 1382196 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382193 unspecified role unspecified role bait bait association association false false false 5Aii R1881 or Metribolone- " the gold standard AR agonist." (Sigma) Binding of Siah2 to the AREs of PSA, NKX3.1, and PMEPA1 was reduced by knockdown of AR or Siah2. siah2-klk3-4 1382187 n/a 1382193 unspecified role unspecified role bait bait n/a 1382198 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5A Binding of Siah2 to the AREs of PSA, NKX3.1, and PMEPA1 was reduced by knockdown of AR or Siah2, but not for the TMPRSS2 gene. siah2-klk3-5 1382187 n/a 1382194 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382197 unspecified role unspecified role bait bait association association false false false 5C R1881 or Metribolone- " the gold standard AR agonist." (Sigma) Binding of AR and NCOR1 to the AREs of PSA was increased by knockdown of Siah2. ar-klk3-1 1382187 n/a 1382194 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382199 unspecified role unspecified role bait bait association association false false false 5Ci R1881 or Metribolone- " the gold standard AR agonist." (Sigma) Binding of AR and NCOR1 to the AREs of PSA was increased by knockdown of Siah2. siah2-klk3-7 1382187 n/a 1382194 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382216 unspecified role unspecified role bait bait association association false false false 5J Knockdown of NCOR1 increased the amount of p300 binding, wheras knockdown of Siah2 decreased the amount of p300 binding. R1881 -Metribolone, a synthetic androgen. siah2-nkx3_1-1 1382187 n/a 1382197 unspecified role unspecified role bait bait n/a 1382195 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false supp 5H R1881 or Metribolone- " the gold standard AR agonist." (Sigma) Siah2 knockdown in LNCaP and Rv1 cells increased the level of AR and NCOR1 on the AREs of PSA, NKX3.1, and PMEPA1. Knockdown of NCOR1 attenuated the recruitment of Siah2 and the accumulation of AR on AREs of PSA, NKX3.1, and PMEPA1 and was further reduced upon Siah2 knockdown. ar-nkx3_1-1 1382187 n/a 1382195 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382199 unspecified role unspecified role bait bait association association false false false supp 5Hi R1881 or Metribolone- " the gold standard AR agonist." (Sigma) Siah2 knockdown in LNCaP and Rv1 cells increased the level of AR and NCOR1 on the AREs of PSA, NKX3.1, and PMEPA1. Knockdown of NCOR1 attenuated the recruitment of Siah2 and the accumulation of AR on AREs of PSA, NKX3.1, and PMEPA1 and was further reduced upon Siah2 knockdown. ncor1-nkx3_1 1382187 n/a 1382196 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382199 unspecified role unspecified role bait bait association association false false false supp 5I R1881 or Metribolone- " the gold standard AR agonist." (Sigma) Siah2 knockdown in LNCaP and Rv1 cells increased the level of AR and NCOR1 on the AREs of PSA, NKX3.1, and PMEPA1. Knockdown of NCOR1 attenuated the recruitment of Siah2 and the accumulation of AR on AREs of PSA, NKX3.1, and PMEPA1 and was further reduced upon Siah2 knockdown. ncor1-pmepa 1382187 n/a 1382196 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382197 unspecified role unspecified role bait bait association association false false false supp 5Ii R1881 or Metribolone- " the gold standard AR agonist." (Sigma) Siah2 knockdown in LNCaP and Rv1 cells increased the level of AR and NCOR1 on the AREs of PSA, NKX3.1, and PMEPA1. Knockdown of NCOR1 attenuated the recruitment of Siah2 and the accumulation of AR on AREs of PSA, NKX3.1, and PMEPA1 and was further reduced upon Siah2 knockdown. ar-tmps2-6 1382187 n/a 1382198 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382197 unspecified role unspecified role bait bait association association false false false Supp 5J Binding of AR and NCOR1 to the AREs of PSA, NKX3.1, and PMEPA1 was increased by knockdown of Siah2, but binding to the TMPRSS2 ARE was unaffected. ar-klk3-1 1382188 n/a 1382194 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382193 unspecified role unspecified role prey prey n/a 1382197 unspecified role unspecified role bait bait association association false false false 5H Siah2 interacted with AR and NCOR1 but not with p300 on the PSA gene. ar-klk3-1 1382188 n/a 1382199 unspecified role unspecified role bait bait n/a 1382193 unspecified role unspecified role prey prey n/a 1382194 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5Hi Siah2 interacted with AR and NCOR1 but not with p300 on the PSA gene. ar-klk3-1 1382188 n/a 1382194 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382216 unspecified role unspecified role prey prey n/a 1382197 unspecified role unspecified role bait bait association association false false false 5I NCOR1 and co-activator p300 are present in distinct AR complexes on the PSA gene. ar-ep300 1382188 n/a 1382194 unspecified role unspecified role prey prey androgen_response_elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1382197 unspecified role unspecified role bait bait n/a 1382199 unspecified role unspecified role prey prey association association false false false 5Ii NCOR1 and co-activator p300 are present in distinct AR complexes on the PSA gene. ar-siah2-1 1382189 n/a 1382217 unspecified role unspecified role prey prey c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q06986:p.[His99Ala;Cys102Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1382197 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P10275:p.Arg727Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P10275:p.Phe755Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P10275:p.Leu702His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P10275:p.Val716Met mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P10275:p.His875Tyr mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P10275:p.Thr878Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P10275:p.Val731Met mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P10275:p.Gln799Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 4A/4G, 5F, S4L. Two solvent-accessible surfaces on AR LBD are required for the interaction with Siah2. ar-ar-2 1382189 n/a 1382197 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false lbd_including_af2_transactivation_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1382217 unspecified role unspecified role prey prey c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q06986:p.[His99Ala;Cys102Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1382197 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false af1_transactivation_domain sufficient to bind sufficient binding region sufficient to bind range range range range false association association false false false supp 5G Overexpression of Siah2 in 293T cells did not affect the AR intermolecular N-terminal and C-terminal interaction. ar-ncor1-3 1382189 n/a 1382217 unspecified role unspecified role ancillary ancillary Q06986:p.[His99Ala;Cys102Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1382199 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1382197 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false 5F A markedly higher association of Siah2 with the AR/NCOR1 complex is shown, rather than with AR alone. ar-siah2-2 1382190 n/a 1382217 unspecified role unspecified role prey prey c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1382197 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supp 4A siah2-ar 1382191 n/a 1382217 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1382197 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false lbd_including_af2_transactivation_domain sufficient to bind sufficient binding region sufficient to bind range range range range false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false 4E siah2-ar-1 1382192 n/a 1382197 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1382217 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false sbd_domain sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined range range false central_ring_zn_finger_domains sufficient to bind sufficient binding region sufficient to bind range range undetermined undetermined sequence position undetermined false physical association physical association false false false 4F