IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ jinesh-2015-1 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Jinesh GG, Kamat AM, Jinesh GG, Kamat AM Cancer - Interactions investigated in the context of cancer 23-07-2015: Submitted by GG Jinesh, MD Anderson Cancer Center, Texas, USA. http://www.nature.com/articles/cddiscovery201569 Blebbishield formation is induced by "Blebbishield Ejection (BE) medium", which contains LiCl and Cisplatin; the latter crosslinking DNA leading to apoptosis. A bleb is a bulge, or protrusion of the plasma membrane; apoptotic blebs of cancer cells fuse together to form novel structures called 'blebbishields' which act to resist apoptosis and aid survival of these cells. Sequence range for beta-catenin cleaved fragment was taken from PMID:10748026. RPS6KB1 (p70S6K) isoforms were not entered as different participants since they could not be mapped to isoforms defined in UniProtKB. Every other isoform or cleavage fragment reported in this entry has been identified as per author statements. GJGerald@mdanderson.org,akamat@mdanderson.org GJGerald@mdanderson.org 2016 Only protein-protein interactions imex curation Jinesh GG, Kamat AM Cell Death Discovery jinesh-2015-2 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Jinesh GG, Kamat AM, Jinesh GG, Kamat AM Cancer - Interactions investigated in the context of cancer 23-07-2015: Submitted by GG Jinesh, MD Anderson Cancer Center, Texas, USA. http://www.nature.com/articles/cddiscovery201569 A bleb is a bulge, or protrusion of the plasma membrane ;apoptotic blebs of cancer cells fuse together to form novel structures called 'blebbishields', which act to resist apoptosis and aid survival of these cells. Blebbishield Ejection (BE) medium, which contains LiCl and Cisplatin, induces the formation of 'blebbishields'. Blebbishield formation is induced by "Blebbishield Ejection (BE) medium", which contains LiCl and Cisplatin; the latter crosslinking DNA leading to apoptosis. A bleb is a bulge, or protrusion of the plasma membrane; apoptotic blebs of cancer cells fuse together to form novel structures called 'blebbishields' which act to resist apoptosis and aid survival of these cells. Sequence range for beta-catenin cleaved fragment was taken from PMID:10748026. RPS6KB1 (p70S6K) isoforms were not entered as different participants since they could not be mapped to isoforms defined in UniProtKB. Every other isoform or cleavage fragment reported in this entry has been identified as per author statements. GJGerald@mdanderson.org,akamat@mdanderson.org GJGerald@mdanderson.org 2016 Only protein-protein interactions imex curation Jinesh GG, Kamat AM Cell Death Discovery jinesh-2015-3 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Jinesh GG, Kamat AM, Jinesh GG, Kamat AM Cancer - Interactions investigated in the context of cancer 23-07-2015: Submitted by GG Jinesh, MD Anderson Cancer Center, Texas, USA. http://www.nature.com/articles/cddiscovery201569 Blebbishield formation is induced by "Blebbishield Ejection (BE) medium", which contains LiCl and Cisplatin; the latter crosslinking DNA leading to apoptosis. A bleb is a bulge, or protrusion of the plasma membrane; apoptotic blebs of cancer cells fuse together to form novel structures called 'blebbishields' which act to resist apoptosis and aid survival of these cells. Sequence range for beta-catenin cleaved fragment was taken from PMID:10748026. RPS6KB1 (p70S6K) isoforms were not entered as different participants since they could not be mapped to isoforms defined in UniProtKB. Every other isoform or cleavage fragment reported in this entry has been identified as per author statements. GJGerald@mdanderson.org,akamat@mdanderson.org GJGerald@mdanderson.org 2016 Only protein-protein interactions imex curation Jinesh GG, Kamat AM Cell Death Discovery jinesh-2015-4 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Jinesh GG, Kamat AM, Jinesh GG, Kamat AM Cancer - Interactions investigated in the context of cancer 23-07-2015: Submitted by GG Jinesh, MD Anderson Cancer Center, Texas, USA. http://www.nature.com/articles/cddiscovery201569 Blebbishield formation is induced by "Blebbishield Ejection (BE) medium", which contains LiCl and Cisplatin; the latter crosslinking DNA leading to apoptosis. A bleb is a bulge, or protrusion of the plasma membrane; apoptotic blebs of cancer cells fuse together to form novel structures called 'blebbishields' which act to resist apoptosis and aid survival of these cells. Sequence range for beta-catenin cleaved fragment was taken from PMID:10748026. RPS6KB1 (p70S6K) isoforms were not entered as different participants since they could not be mapped to isoforms defined in UniProtKB. Every other isoform or cleavage fragment reported in this entry has been identified as per author statements. GJGerald@mdanderson.org,akamat@mdanderson.org GJGerald@mdanderson.org 2016 Only protein-protein interactions imex curation Jinesh GG, Kamat AM Cell Death Discovery jinesh-2015-5 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Jinesh GG, Kamat AM, Jinesh GG, Kamat AM Cancer - Interactions investigated in the context of cancer 23-07-2015: Submitted by GG Jinesh, MD Anderson Cancer Center, Texas, USA. http://www.nature.com/articles/cddiscovery201569 Blebbishield formation is induced by "Blebbishield Ejection (BE) medium", which contains LiCl and Cisplatin; the latter crosslinking DNA leading to apoptosis. A bleb is a bulge, or protrusion of the plasma membrane; apoptotic blebs of cancer cells fuse together to form novel structures called 'blebbishields' which act to resist apoptosis and aid survival of these cells. Sequence range for beta-catenin cleaved fragment was taken from PMID:10748026. RPS6KB1 (p70S6K) isoforms were not entered as different participants since they could not be mapped to isoforms defined in UniProtKB. Every other isoform or cleavage fragment reported in this entry has been identified as per author statements. GJGerald@mdanderson.org,akamat@mdanderson.org GJGerald@mdanderson.org 2016 Only protein-protein interactions imex curation Jinesh GG, Kamat AM Cell Death Discovery cdc42_human Cell division control protein 42 homolog CDC42 G25K GTP-binding protein protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL q05513-1 Protein kinase C zeta type nPKC-zeta PRKCZ PKC2 protein protein human Homo sapiens Human MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV pak1_human Serine/threonine-protein kinase PAK 1 PAK1 p21-activated kinase 1 p65-PAK Alpha-PAK protein protein human Homo sapiens Human MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH ks6b1_human Ribosomal protein S6 kinase beta-1 RPS6KB1 STK14A Ribosomal protein S6 kinase I p70 ribosomal S6 kinase alpha 70 kDa ribosomal protein S6 kinase 1 Serine/threonine-protein kinase 14A protein protein human Homo sapiens Human MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL vgfr2_human Vascular endothelial growth factor receptor 2 Kinase insert domain receptor Protein-tyrosine kinase receptor flk-1 KDR FLK1 Fetal liver kinase 1 VEGFR2 protein protein human Homo sapiens Human MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPPEIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVPPQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPYPCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGERVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWLLLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLKRRLDSITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSGMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV gnds_human Ral guanine nucleotide dissociation stimulator RALGDS RGF KIAA1308 Ral guanine nucleotide exchange factor protein protein human Homo sapiens Human MVQRMWAEAAGPAGGAEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSFTQLDPDLPRPESSTQEIGEELINGVIYSISLRKVQLHHGGNKGQRWLGYENESALNLYETCKVRTVKAGTLEKLVEHLVPAFQGSDLSYVTIFLCTYRAFTTTQQVLDLLFKRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERRAHLLLAQLEHSEPIEAEPEALSPVPALKPTPELELALTPARAPSPVPAPAPEPEPAPTPAPGSELEVAPAPAPELQQAPEPAVGLESAPAPALELEPAPEQDPAPSQTLELEPAPAPVPSLQPSWPSPVVAENGLSEEKPHLLVFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDKKGKEHLAPTIRATVTQFNSVANCVITTCLGNRSTKAPDRARVVEHWIEVARECRILKNFSSLYAILSALQSNSIHRLKKTWEDVSRDSFRIFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNPKRAQKRPKETGIIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEVIAQIKLLQSACNNYSIAPDEQFGAWFRAVERLSETESYNLSCELEPPSESASNTLRTKKNTAIVKRWSDRQAPSTELSTSGSSHSKSCDQLRCGPYLSSGDIADALSVHSAGSSSSDVEEINISFVPESPDGQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVAATRTHKRSVSGLCNSSSALPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFTKGVKVKHGASSTLPRMKQKGLKIAKGIF cadh1_human Cadherin-1 Epithelial cadherin Uvomorulin CAM 120/80 CDH1 CDHE UVO protein protein human Homo sapiens Human MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDCTGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVGHHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDVNEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTGAISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD q05513-2 Protein kinase C zeta type nPKC-zeta PRKCZ PKC2 PKMzeta protein protein human Homo sapiens Human MDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV Produced by alternative promoter usage. pak1-prkcz-1 1856754 N/A 1856759 unspecified role unspecified role prey prey human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A PKC-zeta iso-1 1856760 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A PAK1-CRIB 1856761 unspecified role unspecified role bait bait purified purified crib domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false escherichia coli dh5[alpha] escherichia coli dh5[alpha] N/A p70S6K 1856762 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line association association false false false 6C, lane ii cdc42-ctnnb1-1 1856754 N/A PKC-zeta 1856760 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A beta-catenin 1856763 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A VEGFR2 1856764 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A cdc42 1856759 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A RalGDS 1856765 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false rbd domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false escherichia coli dh5[alpha] escherichia coli dh5[alpha] N/A 1856766 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A cleaved 72 kDa beta-catenin fragment 1856763 unspecified role unspecified role prey prey cell lysate cell lysate 72 kda cleaved fragment sufficient to bind sufficient binding region sufficient to bind range range range range false human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line association association false false false 6A, lane ii Both full-length and caspase 3-cleaved beta-catenin were pulled-down by RalGDS. pak1-prkcz-2 1856755 N/A 1856759 unspecified role unspecified role prey prey human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A PKC-zeta iso 2 1856767 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A PKC-zeta iso-1 1856760 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A PAK1-CRIB 1856761 unspecified role unspecified role bait bait purified purified crib domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false escherichia coli dh5[alpha] escherichia coli dh5[alpha] N/A p70S6K 1856762 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line association association false false false 6C, lane iii ralgds-cdc42-5 1856755 N/A PKC-zeta 1856760 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A beta-catenin 1856763 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A VEGFR2 1856764 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A cdc42 1856759 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A RalGDS 1856765 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false rbd domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false escherichia coli dh5[alpha] escherichia coli dh5[alpha] N/A 1856766 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A cleaved 72 kDa beta-catenin fragment 1856763 unspecified role unspecified role prey prey cell lysate cell lysate 72 kda cleaved fragment sufficient to bind sufficient binding region sufficient to bind range range range range false human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line association association false false false 6A, lane iii Both full-length and caspase 3-cleaved beta-catenin were pulled-down by RalGDS. pak1-prkcz-3 1856756 N/A 1856759 unspecified role unspecified role prey prey human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A PKM-zeta 1856760 unspecified role unspecified role prey prey cell lysate cell lysate pkm-zeta cleaved form sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A PKC-zeta iso-1 1856760 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A PAK1-CRIB 1856761 unspecified role unspecified role bait bait purified purified crib domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false escherichia coli dh5[alpha] escherichia coli dh5[alpha] N/A p45S6K 1856762 unspecified role unspecified role prey prey cell lysate cell lysate p45s6k cleaved form sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line association association false false false 6C, lane iv ralgds-cdc42-2 1856756 N/A PKC-zeta 1856760 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A 72 kDa cleaved beta-catenin fragment 1856763 unspecified role unspecified role prey prey cell lysate cell lysate 72 kda cleaved fragment sufficient to bind sufficient binding region sufficient to bind range range range range false human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A VEGFR2 1856764 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A cdc42 1856759 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A RalGDS 1856765 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false rbd domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false escherichia coli dh5[alpha] escherichia coli dh5[alpha] association association false false false 6A, lane iv Only caspase 3-cleaved beta-catenin was pulled-down by RalGDS, no full-length protein was present. In blebbishields, RalGDS-RBD selectively lost interactions with E-cadherin and full-length beta-catenin. pak1-prkcz-4 1856757 N/A 1856759 unspecified role unspecified role prey prey human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A PKC-zeta iso 2 1856767 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A PKC-zeta iso-1 1856760 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A PAK1-CRIB 1856761 unspecified role unspecified role bait bait purified purified crib domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false escherichia coli dh5[alpha] escherichia coli dh5[alpha] N/A p70S6K 1856762 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line association association false false false 6C, lane v ralgds-cdc42-1 1856757 N/A PKC-zeta 1856760 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A beta-catenin 1856763 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A VEGFR2 1856764 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A cdc42 1856759 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A RalGDS 1856765 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false rbd domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false escherichia coli dh5[alpha] escherichia coli dh5[alpha] N/A 1856766 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A cleaved 72 kDa beta-catenin fragment 1856763 unspecified role unspecified role prey prey cell lysate cell lysate 72 kda cleaved fragment sufficient to bind sufficient binding region sufficient to bind range range range range false human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line association association false false false 6A, lane v Authors state that both full-length and caspase 3-cleaved beta-catenin were pulled-down by RalGDS. pak1-prkcz-5 1856758 N/A 1856759 unspecified role unspecified role prey prey human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A PKC-zeta iso-1 1856760 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A PAK1-CRIB 1856761 unspecified role unspecified role bait bait purified purified crib domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false escherichia coli dh5[alpha] escherichia coli dh5[alpha] physical association physical association false false false 6C, lane vi ralgds-cdc42-3 1856758 N/A PKC-zeta 1856760 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A beta-catenin 1856763 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A VEGFR2 1856764 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A cdc42 1856759 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A RalGDS 1856765 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false rbd domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false escherichia coli dh5[alpha] escherichia coli dh5[alpha] N/A 1856766 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line N/A cleaved 72 kDa beta-catenin fragment 1856763 unspecified role unspecified role prey prey cell lysate cell lysate 72 kda cleaved fragment sufficient to bind sufficient binding region sufficient to bind range range range range false human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line association association false false false 6A, lane vi Authors state that both full-length and caspase 3-cleaved beta-catenin were pulled-down by RalGDS.