IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhang-2012c-4 Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. human-jeko-1 JEKO-1 Mantle cell lymphoma cell line jeko-1 JEKO-1 Mantle cell lymphoma cell line http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-3006&Template=cellBiology ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. jianguo.tao@moffitt.org jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation chIPs involving antibodies to H3 have not been included due to lack of antibody target specificity. Figure 4A (using 293T cells) cannot be added as the origin of the FLAG-HDAC3/FLAG_MYC constructs cannot be determined. zhang-2012c-3 Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. human-p493-6 Human P493-6 B cell line (condtiional myc) p493-6 Human P493-6 B cell line (condtiional myc) ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. MYC-ON cells:P493-6 cells bear a tetracycline (tet)-repressible MYC construct such that tet withdrawal results in rapid induction of MYC followed by cell proliferation. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. jianguo.tao@moffitt.org jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation chIPs involving antibodies to H3 have not been included due to lack of antibody target specificity. Figure 4A (using 293T cells) cannot be added as the origin of the FLAG-HDAC3/FLAG_MYC constructs cannot be determined. zhang-2012c-2 Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. human-ramos Human Caucasian Burkitt's lymphoma ramos Human Caucasian Burkitt's lymphoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. jianguo.tao@moffitt.org jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation chIPs involving antibodies to H3 have not been included due to lack of antibody target specificity. Figure 4A (using 293T cells) cannot be added as the origin of the FLAG-HDAC3/FLAG_MYC constructs cannot be determined. zhang-2012c-6 Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. human-mino Human Mino Mantle cells - blastic lymphoma cell line mino Human MINO Mantle cell - blastic lymphoma cell line http://www.lgcstandards-atcc.org/LGCAdvancedCatalogueSearch/ProductDescription/tabid/1068/Default.aspx?ATCCNum=CRL-3000&Template=cellBiology ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. jianguo.tao@moffitt.org jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation chIPs involving antibodies to H3 have not been included due to lack of antibody target specificity. Figure 4A (using 293T cells) cannot be added as the origin of the FLAG-HDAC3/FLAG_MYC constructs cannot be determined. zhang-2012c-5 Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. human-b-cell lymphoma Homo sapiens b-cell lymphoma B-cell lymphoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. High grade lymphoma cells expressing high levels of MYC:- two blastic Mantle Cell Lymphomas, one Burkitts lymphoma and one Burkitts-like lymphoma. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. jianguo.tao@moffitt.org jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation chIPs involving antibodies to H3 have not been included due to lack of antibody target specificity. Figure 4A (using 293T cells) cannot be added as the origin of the FLAG-HDAC3/FLAG_MYC constructs cannot be determined. zhang-2012c-8 Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. human-p493-6 Human P493-6 B cell line (condtiional myc) p493-6 Human P493-6 B cell line (condtiional myc) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. P493-6 cells bear a tetracycline (tet)-repressible MYC construct such that tet withdrawal results in rapid induction of MYC followed by cell proliferation. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. jianguo.tao@moffitt.org jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation chIPs involving antibodies to H3 have not been included due to lack of antibody target specificity. Figure 4A (using 293T cells) cannot be added as the origin of the FLAG-HDAC3/FLAG_MYC constructs cannot be determined. zhang-2012c-7 Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. human-jeko-1 JEKO-1 Mantle cell lymphoma cell line jeko-1 JEKO-1 Mantle cell lymphoma cell line http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-3006&Template=cellBiology anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. jianguo.tao@moffitt.org jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation chIPs involving antibodies to H3 have not been included due to lack of antibody target specificity. Figure 4A (using 293T cells) cannot be added as the origin of the FLAG-HDAC3/FLAG_MYC constructs cannot be determined. zhang-2012c-1 Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. 293T cells were cotransfected with vectors expressing FLAG-tagged full-length specific HDAC3 and/or with full-length MYC. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. jianguo.tao@moffitt.org jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation chIPs involving antibodies to H3 have not been included due to lack of antibody target specificity. Figure 4A (using 293T cells) cannot be added as the origin of the FLAG-HDAC3/FLAG_MYC constructs cannot be determined. hdac3_human Histone deacetylase 3 HDAC3 RPD3-2 SMAP45 protein protein human Homo sapiens Human MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI pri-mir-29b2_29c_regulatory_region Human pri-miR-29b2/29c Regulatory Region dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human pri-mir-29a_29b1_regulatory_region Human pri-miR-29a/29b1 Regulatory Region dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human myc_human Myc proto-oncogene protein BHLHE39 Transcription factor p64 MYC Proto-oncogene c-Myc Class E basic helix-loop-helix protein 39 protein protein human Homo sapiens Human MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA ezh2_human Histone-lysine N-methyltransferase EZH2 KMT6 Enhancer of zeste homolog 2 ENX-1 Lysine N-methyltransferase 6 EZH2 protein protein human Homo sapiens Human MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP suz12_human Polycomb protein SUZ12 CHET9 JJAZ1 KIAA0160 SUZ12 Suppressor of zeste 12 protein homolog Joined to JAZF1 protein Chromatin precipitated E2F target 9 protein protein protein human Homo sapiens Human MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL rpb1_human DNA-directed RNA polymerase II subunit RPB1 POLR2A DNA-directed RNA polymerase II subunit A DNA-directed RNA polymerase III largest subunit POLR2 RNA-directed RNA polymerase II subunit RPB1 protein protein human Homo sapiens Human MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPASPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG mir-494 microRNA 494 gene gene human Homo sapiens Human hdac3-mir_29b2-3 1322904 n/a 1322912 unspecified role unspecified role bait bait n/a 1322913 unspecified role unspecified role prey prey association association false false false 3B-1 Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. hdac3-mir_29a-9 1322904 n/a 1322914 unspecified role unspecified role prey prey n/a 1322912 unspecified role unspecified role bait bait association association false false false 3B-4 Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. myc-mir_29b2-1 1322904 n/a 1322913 unspecified role unspecified role prey prey n/a 1322915 unspecified role unspecified role bait bait association association false false false 3B-2 Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. myc-mir_29a-3 1322904 n/a 1322914 unspecified role unspecified role prey prey n/a 1322915 unspecified role unspecified role bait bait association association false false false 3B-3 Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. ezh2-mir_29a-6 1322904 n/a 1322914 unspecified role unspecified role prey prey n/a 1322916 unspecified role unspecified role bait bait association association false false false 3Di-1 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. suz12-mir_29b2 1322904 n/a 1322913 unspecified role unspecified role prey prey n/a 1322917 unspecified role unspecified role bait bait association association false false false 3Dii-2 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. ezh2-mir_29b2-3 1322904 n/a 1322916 unspecified role unspecified role bait bait n/a 1322913 unspecified role unspecified role prey prey association association false false false 3D-2 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. suz12-mir_29a-2 1322904 n/a 1322917 unspecified role unspecified role bait bait n/a 1322914 unspecified role unspecified role prey prey association association false false false 3Diii 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. polr2a-mir_29b2-2 1322904 n/a 1322918 unspecified role unspecified role bait bait n/a 1322913 unspecified role unspecified role prey prey association association false false false S3F(E) 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. Binding is increased in the presence of DZNep. HDAC3 knockdown by shRNA polr2a-mir_29a-2 1322904 n/a 1322918 unspecified role unspecified role bait bait n/a 1322914 unspecified role unspecified role prey prey association association false false false S3F(E)-2 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. Binding is increased in the presence of DZNep. HDAC3 knockdown by shRNA polr2a-mir_29a-3 1322904 n/a 1322914 unspecified role unspecified role prey prey n/a 1322919 unspecified role unspecified role bait bait region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false S3F(E) HDAC3 knockdown by shRNA hist1h4a-mir_29a-2 1322904 n/a 1322919 unspecified role unspecified role bait bait region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1322913 unspecified role unspecified role prey prey association association false false false S3F(E)-ii HDAC3 knockdown by shRNA hdac3-mir_29b2-8 1322905 n/a 1322915 unspecified role unspecified role ancillary ancillary n/a 1322912 unspecified role unspecified role bait bait n/a 1322913 unspecified role unspecified role prey prey association association false false false 3C-1 Both EZH2 and SUZ12 bound to the miR-29 promoters in MYC-on but not in MYC-off P493-6 lymphocytes. hdac3-mir_29a-12 1322905 n/a 1322914 unspecified role unspecified role prey prey n/a 1322912 unspecified role unspecified role bait bait n/a 1322915 unspecified role unspecified role ancillary ancillary association association false false false 3C Both EZH2 and SUZ12 bound to the miR-29 promoters in MYC-on but not in MYC-off P493-6 lymphocytes. myc-mir_29a-1 1322905 n/a 1322914 unspecified role unspecified role prey prey n/a 1322915 unspecified role unspecified role bait bait association association false false false 3C-3 Both EZH2 and SUZ12 bound to the miR-29 promoters in MYC-on but not in MYC-off P493-6 lymphocytes. myc-mir_29b2-1 1322905 n/a 1322915 unspecified role unspecified role bait bait n/a 1322913 unspecified role unspecified role prey prey association association false false false 3C-2 Both EZH2 and SUZ12 bound to the miR-29 promoters in MYC-on but not in MYC-off P493-6 lymphocytes. ezh2-mir_29b2-6 1322905 n/a 1322915 unspecified role unspecified role ancillary ancillary n/a 1322916 unspecified role unspecified role bait bait n/a 1322913 unspecified role unspecified role prey prey association association false false false 3C-5 Both EZH2 and SUZ12 bound to the miR-29 promoters in MYC-on but not in MYC-off P493-6 lymphocytes. ezh2-mir_29a-9 1322905 n/a 1322915 unspecified role unspecified role ancillary ancillary n/a 1322916 unspecified role unspecified role bait bait n/a 1322914 unspecified role unspecified role prey prey association association false false false 3C-6 Both EZH2 and SUZ12 bound to the miR-29 promoters in MYC-on but not in MYC-off P493-6 lymphocytes. suz12-mir_29b2-3 1322905 n/a 1322915 unspecified role unspecified role ancillary ancillary n/a 1322913 unspecified role unspecified role prey prey n/a 1322917 unspecified role unspecified role bait bait association association false false false 3C-7 Both EZH2 and SUZ12 bound to the miR-29 promoters in MYC-on but not in MYC-off P493-6 lymphocytes. suz12-mir_29a-5 1322905 n/a 1322914 unspecified role unspecified role prey prey n/a 1322917 unspecified role unspecified role bait bait n/a 1322915 unspecified role unspecified role ancillary ancillary association association false false false 3C-8 Both EZH2 and SUZ12 bound to the miR-29 promoters in MYC-on but not in MYC-off P493-6 lymphocytes. hist1h4a-mir_29a-3 1322905 n/a 1322914 unspecified role unspecified role prey prey n/a 1322919 unspecified role unspecified role bait bait region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1322915 unspecified role unspecified role ancillary ancillary association association false false false S3D Enrichment of Ac-H4 and Pol2 was significantly increased and Me3-H3K27 is significantly decreased in MYC-off P493-6 cells. polr2a-mir_29a-5 1322905 n/a 1322915 unspecified role unspecified role ancillary ancillary n/a 1322914 unspecified role unspecified role prey prey n/a 1322918 unspecified role unspecified role bait bait association association false false false S3D Enrichment of Ac-H4 and Pol2 was significantly increased and Me3-H3K27 is significantly decreased in MYC-off P493-6 cells. polr2a-mir_29b2-3 1322905 n/a 1322913 unspecified role unspecified role prey prey n/a 1322918 unspecified role unspecified role bait bait n/a 1322915 unspecified role unspecified role ancillary ancillary association association false false false S3Dii Enrichment of Ac-H4 and Pol2 was significantly increased and Me3-H3K27 is significantly decreased in MYC-off P493-6 cells. hist1h4a-mir_29b2 1322905 n/a 1322915 unspecified role unspecified role ancillary ancillary n/a 1322913 unspecified role unspecified role prey prey n/a 1322919 unspecified role unspecified role bait bait region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false S3D-2 Enrichment of Ac-H4 and Pol2 was significantly increased and Me3-H3K27 is significantly decreased in MYC-off P493-6 cells. hdac3-mir_29b2 1322906 n/a 1322912 unspecified role unspecified role bait bait n/a 1322913 unspecified role unspecified role prey prey association association false false false 3B-1 Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. myc-mir_29a-2 1322906 n/a 1322914 unspecified role unspecified role prey prey n/a 1322915 unspecified role unspecified role bait bait association association false false false 3B-3 Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. myc-mir_29b2-1 1322906 n/a 1322915 unspecified role unspecified role bait bait n/a 1322913 unspecified role unspecified role prey prey association association false false false 3B-2 Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. hdac3-mir_29a-8 1322906 n/a 1322912 unspecified role unspecified role bait bait n/a 1322914 unspecified role unspecified role prey prey association association false false false 3B-4 Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. suz12-mir_29a-1 1322906 n/a 1322917 unspecified role unspecified role bait bait n/a 1322914 unspecified role unspecified role prey prey association association false false false 3D 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. ezh2-mir_29a-5 1322906 n/a 1322914 unspecified role unspecified role prey prey n/a 1322916 unspecified role unspecified role bait bait association association false false false 3Di 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. ezh2-mir_29b2-1 1322906 n/a 1322913 unspecified role unspecified role prey prey n/a 1322916 unspecified role unspecified role bait bait association association false false false 3D 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. ezh2-mir_29b2-2 1322906 n/a 1322913 unspecified role unspecified role prey prey n/a 1322917 unspecified role unspecified role bait bait association association false false false 3Dii 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. polr2a-mir_29a-1 1322906 n/a 1322918 unspecified role unspecified role bait bait n/a 1322914 unspecified role unspecified role prey prey association association false false false S3E-ii(F) 3-Deazaneplanocin A (DZNep), a global histone methylation inhibitor - used as an HDAC and EZH2 inhibitor. Binding is increased in the presence of DZNep. polr2a-mir_29b2-1 1322906 n/a 1322913 unspecified role unspecified role prey prey n/a 1322918 unspecified role unspecified role bait bait association association false false false S3E-3(F) 3-Deazaneplanocin A (DZNep), a global histone methylation inhibitor - used as an HDAC and EZH2 inhibitor. Binding is increased in the presence of DZNep. suz12-mir_29b2-2 1322906 n/a 1322917 unspecified role unspecified role bait bait n/a 1322920 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S5F 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. ezh2-mir_29b2-5 1322907 n/a 1322913 unspecified role unspecified role prey prey n/a 1322916 unspecified role unspecified role bait bait association association false false false S3B 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. suz12-mir_29a-4 1322907 n/a 1322917 unspecified role unspecified role bait bait n/a 1322914 unspecified role unspecified role prey prey association association false false false S3B 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. ezh2-mir_29b2-5 1322907 n/a 1322917 unspecified role unspecified role bait bait n/a 1322913 unspecified role unspecified role prey prey association association false false false S3B 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. ezh2-mir_29a-8 1322907 n/a 1322914 unspecified role unspecified role prey prey n/a 1322916 unspecified role unspecified role bait bait association association false false false S3B 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. hdac3-mir_29a-11 1322907 n/a 1322912 unspecified role unspecified role bait bait n/a 1322914 unspecified role unspecified role prey prey association association false false false S3A Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. myc-mir_29b2-1 1322907 n/a 1322915 unspecified role unspecified role bait bait n/a 1322913 unspecified role unspecified role prey prey association association false false false S3A Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. myc-mir_29a-5 1322907 n/a 1322915 unspecified role unspecified role bait bait n/a 1322914 unspecified role unspecified role prey prey association association false false false S3A Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. hdac3-mir_29b2-7 1322907 n/a 1322913 unspecified role unspecified role prey prey n/a 1322912 unspecified role unspecified role bait bait association association false false false S3A Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. suz12-mir_29b2-1 1322907 n/a 1322913 unspecified role unspecified role prey prey n/a 1322918 unspecified role unspecified role bait bait association association false false false S3E(F) polr2a-mir_29b2 1322907 n/a 1322914 unspecified role unspecified role prey prey n/a 1322918 unspecified role unspecified role bait bait association association false false false S3E-1(F) hdac3-mir_29b2-6 1322908 n/a 1322912 unspecified role unspecified role bait bait n/a 1322913 unspecified role unspecified role prey prey association association false false false 3E ezh2-mir_29b2-4 1322908 n/a 1322917 unspecified role unspecified role bait bait n/a 1322913 unspecified role unspecified role prey prey association association false false false 3E suz12-mir_29a-3 1322908 n/a 1322917 unspecified role unspecified role bait bait n/a 1322914 unspecified role unspecified role prey prey association association false false false 3E myc-mir_29b2-1 1322908 n/a 1322915 unspecified role unspecified role bait bait n/a 1322913 unspecified role unspecified role prey prey association association false false false 3E hdac3-mir_29a-10 1322908 n/a 1322912 unspecified role unspecified role bait bait n/a 1322914 unspecified role unspecified role prey prey association association false false false 3E myc-mir_29a-4 1322908 n/a 1322914 unspecified role unspecified role prey prey n/a 1322915 unspecified role unspecified role bait bait association association false false false 3E hdac3-mir_29b2-6 1322908 n/a 1322916 unspecified role unspecified role bait bait n/a 1322913 unspecified role unspecified role prey prey association association false false false 3E ezh2-mir_29a-7 1322908 n/a 1322914 unspecified role unspecified role prey prey n/a 1322916 unspecified role unspecified role bait bait association association false false false 3E myc-hdac3 1322909 n/a 1322915 unspecified role unspecified role bait bait n/a 1322912 unspecified role unspecified role prey prey n/a 1322917 unspecified role unspecified role prey prey association association false false false 4C-1 hdac3-ezh2 1322909 n/a 1322916 unspecified role unspecified role prey prey n/a 1322912 unspecified role unspecified role bait bait n/a 1322915 unspecified role unspecified role prey prey n/a 1322917 unspecified role unspecified role prey prey association association false false false 4C-2 In MYC-OFF cells a weaker interaction is seen between HDAC3, SUZ12 and EZH2. suz12-ezh2 1322909 n/a 1322916 unspecified role unspecified role prey prey n/a 1322912 unspecified role unspecified role prey prey n/a 1322915 unspecified role unspecified role prey prey n/a 1322917 unspecified role unspecified role bait bait association association false false false 4C-3 In MYC-OFF cells a weaker interaction is seen between HDAC3, SUZ12 and EZH2. ezh2-hdac3 1322909 n/a 1322917 unspecified role unspecified role prey prey n/a 1322912 unspecified role unspecified role prey prey n/a 1322916 unspecified role unspecified role bait bait association association false false false 4C-4/4D In MYC-OFF cells a weaker interaction is seen between HDAC3, SUZ12 and EZH2. In MYC-ON cells with transfected si-HDAC3 the reaction between SUZ12 and EZH2 was preserved. hdac3-ezh2-1 1322909 n/a 1322916 unspecified role unspecified role prey prey n/a 1322917 unspecified role unspecified role prey prey n/a 1322912 unspecified role unspecified role bait bait association association false false false 4C-5 In MYC-OFF cells a weaker interaction is seen between HDAC3, SUZ12 and EZH2. suz12-ezh2-1 1322909 n/a 1322916 unspecified role unspecified role prey prey n/a 1322912 unspecified role unspecified role prey prey n/a 1322917 unspecified role unspecified role bait bait association association false false false 4C-6/4D In MYC-OFF cells a weaker interaction is seen between HDAC3, SUZ12 and EZH2. In MYC-ON cells with transfected si-HDAC3 the interaction between SUZ12 and EZH2 was preserved wheras the interaction with SUZ12/ MYC was not. suz12-hdac3 1322910 n/a 1322912 unspecified role unspecified role prey prey n/a 1322917 unspecified role unspecified role bait bait physical association physical association false false false 4B hdac3-suz12 1322910 n/a 1322912 unspecified role unspecified role bait bait n/a 1322917 unspecified role unspecified role prey prey physical association physical association false false false 4B myc-hdac3-1 1322911 n/a 1322915 unspecified role unspecified role bait bait n/a 1322912 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 4A hdac3-ezh2-2 1322911 n/a 1322912 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1322917 unspecified role unspecified role prey prey n/a 1322915 unspecified role unspecified role prey prey association association false false false 4A In MYC-OFF cells a weaker interaction is seen between HDAC3, SUZ12 and EZH2.