IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ brunquell-2012-1 TLE1 is an anoikis regulator and is downregulated by Bit1 in breast cancer cells. human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Brunquell C., Biliran H., Jenings S., Ireland S.K., Chen R., Ruoslahti E. Cancer - Interactions investigated in the context of cancer hbiliran@xula.edu Mol. Cancer Res. (1541-7786) 2012 Only protein-protein interactions imex curation Apoptosis - Interactions involving proteins with a function related to apoptosis pth2_human Peptidyl-tRNA hydrolase 2, mitochondrial PTRH2 BIT1 PTH2 CGI-147 Bcl-2 inhibitor of transcription 1 protein protein human Homo sapiens Human MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY tle5_human TLE family member 5 TLE5 AES Amino-terminal enhancer of split GRG GRG5 Gp130-associated protein GAM Grg-5 Groucho-related protein 5 Protein ESP1 Protein GRG TLE family member 5, transcriptional modulator protein protein human Homo sapiens Human MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD ptrh2-aes 1322650 n/a 1322651 unspecified role unspecified role bait bait n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1322652 unspecified role unspecified role prey prey physical association physical association false false false 5e Co-transfection with protein TLE1 disrupts the interaction. The interaction is only visible in cells undergoing anoikis (apoptosis induced by detachment of cells).