IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ von-2012-1 ETS-dependent p16INK4a and p21waf1/cip1 gene expression upon endothelin-1 stimulation in malignant versus and non-malignant proximal tubule cells. human-caki_1 Homo sapiens caki_1 Human clear-cell renal-cell carcinoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot von Brandenstein M., Schlosser M., Richter C., Depping R., Fries J.W. Cancer - Interactions investigated in the context of cancer EMSA experiments were not curated since the gel shift claimed by the authors was barely noticeable. The authors were contacted but did not reply. jochen.fries@uni-koeln.de Life Sci. (0024-3205) 2012 Only protein-protein interactions imex curation Affinomics - Interactions curated for the Affinomics consortium. von-2012-2 ETS-dependent p16INK4a and p21waf1/cip1 gene expression upon endothelin-1 stimulation in malignant versus and non-malignant proximal tubule cells. human-caki_1 Homo sapiens caki_1 Human clear-cell renal-cell carcinoma cell line pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection von Brandenstein M., Schlosser M., Richter C., Depping R., Fries J.W. Cancer - Interactions investigated in the context of cancer EMSA experiments were not curated since the gel shift claimed by the authors was barely noticeable. The authors were contacted but did not reply. jochen.fries@uni-koeln.de Life Sci. (0024-3205) 2012 Only protein-protein interactions imex curation Affinomics - Interactions curated for the Affinomics consortium. q16539-3 Mitogen-activated protein kinase 14 MAPK14 CSBP CSBP1 CSBP2 CSPB1 MXI2 SAPK2A Cytokine suppressive anti-inflammatory drug-binding protein MAP kinase MXI2 MAX-interacting protein 2 Mitogen-activated protein kinase p38 alpha Stress-activated protein kinase 2a protein protein human Homo sapiens Human MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLGKLTIYPHLMDIELVMI ets1_human Protein C-ets-1 p54 ETS1 EWSR2 protein protein human Homo sapiens Human MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE mk01_human Mitogen-activated protein kinase 1 MAPK1 ERK2 PRKM1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 PRKM2 protein protein human Homo sapiens Human MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS ets1-mapk1-1 1434967 n/a 1434969 unspecified role unspecified role prey prey n/a 1434970 unspecified role unspecified role bait bait n/a 1434971 unspecified role unspecified role prey prey association association false false false 4 mapk1-mapk14 1434967 n/a 1434971 unspecified role unspecified role bait bait n/a 1434969 unspecified role unspecified role prey prey physical association physical association false false false 4 mapk14-mapk1-2 1434967 n/a 1434969 unspecified role unspecified role bait bait n/a 1434971 unspecified role unspecified role prey prey physical association physical association false false false 4 ets1-mapk1-2 1434968 n/a 1434971 unspecified role unspecified role neutral component neutral component n/a 1434970 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 5 Endothelin-1. mapk14-mapk1 1434968 n/a 1434969 unspecified role unspecified role neutral component neutral component n/a 1434971 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 5 Endothelin-1.