IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ su-2012-7 Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. human-synovial_sarcoma Homo sapiens synovial_sarcoma synovial_sarcoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation su-2012-10 Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. human-syo-1 Human SYO-1 Synovial sarcoma cell line syo-1 Human SYO-1 Synovial sarcoma cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation su-2012-11 Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. mouse-synovial_sarcoma mouse synovial sarcoma synovial_sarcoma synovial_sarcoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation su-2012-2 Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. human-syo-1 Human SYO-1 Synovial sarcoma cell line syo-1 Human SYO-1 Synovial sarcoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation su-2012-4 Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. mouse-synovial_sarcoma mouse synovial sarcoma synovial_sarcoma synovial_sarcoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation su-2012-3 Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. human-synovial_sarcoma Homo sapiens synovial_sarcoma synovial_sarcoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation su-2012-6 Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation su-2012-9 Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. human-syo-1 Human SYO-1 Synovial sarcoma cell line syo-1 Human SYO-1 Synovial sarcoma cell line emsa supershift electrophoretic mobility supershift assay emsa supershift tag visualisation tag visualisation Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation su-2012-12 Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. human-ccl-153 Human CCL-153, human fetal lung fibroblast cell line (normal) ccl-153 human fetal lung fibroblast cell line (normal) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation su-2012-13 Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation su-2012-15 Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation su-2012-1 Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. human-syo-1 Human SYO-1 Synovial sarcoma cell line syo-1 Human SYO-1 Synovial sarcoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip sequence tag sequence tag identification sequence tag Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation su-2012-5 Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. human-syo-1 Human SYO-1 Synovial sarcoma cell line syo-1 Human SYO-1 Synovial sarcoma cell line density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation su-2012-8 Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. emsa supershift electrophoretic mobility supershift assay emsa supershift tag visualisation tag visualisation Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation su-2012-14 Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. human-fuji FUJI -Human Synovial Sarcoma cell line expressing SYT-SSX2 fusion protein. fuji FUJI -Human Synovial Sarcoma cell line expressing SYT-SSX2 fusion protein. human synovial sarcoma cell line=fusion transcript, Fuji cells = SYT-SSX2. Ref =Nojima,T. et al;. (1990) Acta Pathol. Jap., 40, 487- =PMID: 2171298 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation su-2012-16 Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation atf2_human Cyclic AMP-dependent transcription factor ATF-2 ATF2 CREB2 CREBP1 Activating transcription factor 2 cAMP response element-binding protein CRE-BP1 HB16 Cyclic AMP-responsive element-binding protein 2 protein protein human Homo sapiens Human MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGSGLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQSTEPALSQIVMAPSSQSQPSGS egr1_human_gene Early growth response 1 Human gene gene gene human Homo sapiens Human tle1_human Transducin-like enhancer protein 1 TLE1 Enhancer of split groucho-like protein 1 E(Sp1) homolog protein protein human Homo sapiens Human MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELNAIIGQQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGGSAGLLALSSALSGQSHLAIKDDKKHHDAEHHRDREPGTSNSLLVPDSLRGTDKRRNGPEFSNDIKKRKVDDKDSSHYDSDGDKSDDNLVVDVSNEDPSSPRASPAHSPRENGIDKNRLLKKDASSSPASTASSASSTSLKSKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPLVNQAAAGLRTPLAVPGPYPAPFGMVPHAGMNGELTSPGAAYASLHNMSPQMSAAAAAAAVVAYGRSPMVGFDPPPHMRVPTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY a4piw0_human SYT-SSX2 protein protein human Homo sapiens Human MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQGNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPGQQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQIMPKKPAEEGNDSEEVPEASGPQNDGKELCPPGKPTTSEKIHERSGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE a4piv8_human SYT-SSX1 protein protein human Homo sapiens Human MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQGNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPGQQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQIMPKKPAEDENDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE atf3_human_gene cAMP-dependent transcription factor ATF-3 gene gene human Homo sapiens Human cd2a2_human_gene Cyclin-dependent kinase inhibitor 2A- CDKN2A gene gene human Homo sapiens Human dus1_human_gene Dual specificity protein phosphatase 1 gene gene human Homo sapiens Human fos_human_gene Human FOS gene gene gene human Homo sapiens Human nupr1_human_gene Human NUPR1 gene gene gene human Homo sapiens Human meis2_human_gene Human MEIS2 gene gene gene human Homo sapiens Human hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA ezh2_human Histone-lysine N-methyltransferase EZH2 KMT6 Enhancer of zeste homolog 2 ENX-1 Lysine N-methyltransferase 6 EZH2 protein protein human Homo sapiens Human MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP egr1_mouse_gene Mouse EGR1 gene gene gene mouse Mus musculus Mouse atf3_mouse_gene Mouse ATF3 gene gene gene mouse Mus musculus Mouse atf2_mouse Cyclic AMP-dependent transcription factor ATF-2 Atf2 Activating transcription factor 2 cAMP response element-binding protein CRE-BP1 MXBP protein protein protein mouse Mus musculus Mouse MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGSGLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSSEDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQSTEPALSQIVMAPPSQAQPSGS tle1_mouse Transducin-like enhancer protein 1 Groucho-related protein 1 Tle1 Grg1 protein protein mouse Mus musculus Mouse MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELNAIIGQQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGGSASLLALSSALSGQSHLAIKDDKKHHDAERHRDRESGTSNSLLVPDSLRSTDKRRNGPEFSSDIKKRKVDDKDNYDSDGDKSDDNLVVDVSNEDPSSPHASPTHSPRENGIDKNRLLKKDASGSPASTASSGSSSSLKSKEVSLHEKANTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAMEPLVNQAAAGLRTPLAVPGPYPAPFGMVPHAGMNGELTSPGAAYAGLHSMSPQMSAAAAAAAAAVVAYGRSPMVGFDPPPHMRVPSIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY hdac1_mouse Histone deacetylase 1 Hdac1 protein protein mouse Mus musculus Mouse MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA ezh2_mouse Histone-lysine N-methyltransferase EZH2 Ezh2 Enx1h Enhancer of zeste homolog 2 ENX-1 protein protein mouse Mus musculus Mouse MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKTMFSSNRQKILERTETLNQEWKQRRIQPVHIMTSVSSLRGTRECSVTSDLDFPAQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPDEREEKQKDLEDNRDDKETCPPRKFPADKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTISVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPVPTEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP cd2a2_mouse_gene Cyclin-dependent kinase inhibitor 2A gene gene mouse Mus musculus Mouse dus1_mouse_gene Dual specificity protein phosphatase 1 gene gene mouse Mus musculus Mouse fos_mouse_gene Mouse FOS gene gene gene mouse Mus musculus Mouse meis2_mouse_gene MEIS2_MOUSE gene gene mouse Mus musculus Mouse nupr1_mouse_gene Nuclear protein 1 gene gene mouse Mus musculus Mouse suz12_human Polycomb protein SUZ12 CHET9 JJAZ1 KIAA0160 SUZ12 Suppressor of zeste 12 protein homolog Joined to JAZF1 protein Chromatin precipitated E2F target 9 protein protein protein human Homo sapiens Human MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL eed_human Polycomb protein EED EED WD protein associating with integrin cytoplasmic tails 1 Embryonic ectoderm development protein protein protein human Homo sapiens Human MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR ssxt_human Protein SSXT SS18 SSXT SYT Synovial sarcoma translocated to X chromosome protein Protein SYT protein protein human Homo sapiens Human MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQGNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGHNDYGYQQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPGQQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQGQYGNYQQ cre_oligo_probe consensus CRE (cAMP-responsive element) site probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) AGAGATTGCCTGACGTCAGAGAGCTAG smca2_human Probable global transcription activator SNF2L2 ATP-dependent helicase SMARCA2 SNF2-alpha SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2 SMARCA2 BRM SNF2A SNF2L2 BAF190B Protein brahma homolog BRG1-associated factor 190B protein protein human Homo sapiens Human MSTPTDPGAMPHPGPSPGPGPSPGPILGPSPGPGPSPGSVHSMMGPSPGPPSVSHPMPTMGSTDFPQEGMHQMHKPIDGIHDKGIVEDIHCGSMKGTGMRPPHPGMGPPQSPMDQHSQGYMSPHPSPLGAPEHVSSPMSGGGPTPPQMPPSQPGALIPGDPQAMSQPNRGPSPFSPVQLHQLRAQILAYKMLARGQPLPETLQLAVQGKRTLPGLQQQQQQQQQQQQQQQQQQQQQQQPQQQPPQPQTQQQQQPALVNYNRPSGPGPELSGPSTPQKLPVPAPGGRPSPAPPAAAQPPAAAVPGPSVPQPAPGQPSPVLQLQQKQSRISPIQKPQGLDPVEILQEREYRLQARIAHRIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRQEVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQKLSKAVATWHANTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDRRLAYLLQQTDEYVANLTNLVWEHKQAQAAKEKKKRRRRKKKAEENAEGGESALGPDGEPIDESSQMSDLPVKVTHTETGKVLFGPEAPKASQLDAWLEMNPGYEVAPRSDSEESDSDYEEEDEEEESSRQETEEKILLDPNSEEVSEKDAKQIIETAKQDVDDEYSMQYSARGSQSYYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAEHLGYSNGVINGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEENEEEDEVPDDETLNQMIARREEEFDLFMRMDMDRRREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKIFGRGSRQRRDVDYSDALTEKQWLRAIEDGNLEEMEEEVRLKKRKRRRNVDKDPAKEDVEKAKKRRGRPPAEKLSPNPPKLTKQMNAIIDTVINYKDRCNVEKVPSNSQLEIEGNSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEESEDESNEEEEEEDEEESESEAKSVKVKIKLNKKDDKGRDKGKGKKRPNRGKAKPVVSDFDSDEEQDEREQSEGSGTDDE smca5_human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 SMARCA5 SNF2H WCRF135 Sucrose nonfermenting protein 2 homolog protein protein human Homo sapiens Human MSSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAASAGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGDYRHRRTEQEEDEELLTESSKATNVCTRFEDSPSYVKWGKLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMSEFKRWVPTLRSVCLIGDKEQRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADDFDSWFDTNNCLGDQKLVERLHMVLRPFLLRRIKADVEKSLPPKKEVKIYVGLSKMQREWYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQDSINAYNEPNSTKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRFITDNTVEERIVERAEMKLRLDSIVIQQGRLVDQNLNKIGKDEMLQMIRHGATHVFASKESEITDEDIDGILERGAKKTAEMNEKLSKMGESSLRNFTMDTESSVYNFEGEDYREKQKIAFTEWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPNVQDFQFFPPRLFELLEKEILFYRKTIGYKVPRNPELPNAAQAQKEEQLKIDEAESLNDEELEEKEKLLTQGFTNWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVIEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDTKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKENVYDELRQCIRNSPQFRFDWFLKSRTAMELQRRCNTLITLIERENMELEEKEKAEKKKRGPKPSTQKRKMDGAPDGRGRKKKLKL hdac2_human Histone deacetylase 2 HDAC2 protein protein human Homo sapiens Human MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP atf2-egr1 1281857 n/a 1281873 unspecified role unspecified role bait bait n/a 1281874 unspecified role unspecified role prey prey promoter_region_~100bp_upstream_of_tss binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 4A, 5B/C. tle1-egr1-1 1281857 n/a 1281874 unspecified role unspecified role prey prey promoter_region_~100bp_upstream_of_tss binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281875 unspecified role unspecified role bait bait association association false false false Fig 4A, 5B/C. ssx2-egr1 1281857 n/a 1281876 unspecified role unspecified role prey prey n/a 1281874 unspecified role unspecified role prey prey promoter_region_~100bp_upstream_of_tss binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 4A, 5C. egr1-syt_ssx1 1281857 n/a 1281874 unspecified role unspecified role prey prey promoter_region_~100bp_upstream_of_tss binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281877 unspecified role unspecified role prey prey association association false false false Fig 5B. atf3-syt_ssx1 1281857 n/a 1281878 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281877 unspecified role unspecified role prey prey association association false false false Fig 5B cdnk2a-syt_ssx1 1281857 n/a 1281879 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281877 unspecified role unspecified role prey prey association association false false false Fig 5B. atf2-cdnk2a 1281857 n/a 1281873 unspecified role unspecified role bait bait n/a 1281879 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 5B/C. atf2-atf3 1281857 n/a 1281878 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281873 unspecified role unspecified role bait bait association association false false false Fig 5B/C. atf2-dusp1 1281857 n/a 1281873 unspecified role unspecified role bait bait n/a 1281880 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 5B/C. tle1-dusp1 1281857 n/a 1281880 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281875 unspecified role unspecified role bait bait association association false false false Fig 5B/C. atf3-syt_ssx2 1281857 n/a 1281876 unspecified role unspecified role bait bait n/a 1281878 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 5C syt_ssx1-dusp1 1281857 n/a 1281877 unspecified role unspecified role bait bait n/a 1281880 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 5B. cdnk2a-syt_ssx2-2 1281857 n/a 1281876 unspecified role unspecified role bait bait n/a 1281879 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 5C. syt_ssx2-dus1 1281857 n/a 1281880 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281876 unspecified role unspecified role bait bait association association false false false Fig 5C. tle1-atf3 1281857 n/a 1281878 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281875 unspecified role unspecified role bait bait association association false false false Fig 5B/C. tle1-cdnk2a 1281857 n/a 1281879 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281875 unspecified role unspecified role bait bait association association false false false Fig 5B/C. syt_ssx1-fos 1281857 n/a 1281877 unspecified role unspecified role prey prey n/a 1281881 unspecified role unspecified role prey prey promoter_region_~100bp_upstream_of_tss binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S4B atf2-fos 1281857 n/a 1281881 unspecified role unspecified role prey prey promoter_region_~100bp_upstream_of_tss binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281873 unspecified role unspecified role bait bait association association false false false Fig S4B/C tle1-fos-2 1281857 n/a 1281881 unspecified role unspecified role prey prey promoter_region_~100bp_upstream_of_tss binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281875 unspecified role unspecified role bait bait association association false false false Fig S4B/C atf2-nupr1-1 1281857 n/a 1281873 unspecified role unspecified role bait bait n/a 1281882 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S4 B/C tle1-nupr1-2 1281857 n/a 1281875 unspecified role unspecified role bait bait n/a 1281882 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S4 B/C syt_ssx2-meis2-1 1281857 n/a 1281876 unspecified role unspecified role bait bait n/a 1281883 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S4C syt_ssx2-nupr1-1 1281857 n/a 1281876 unspecified role unspecified role bait bait n/a 1281882 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S4C syt_ssx1-nupr1 1281857 n/a 1281877 unspecified role unspecified role bait bait n/a 1281882 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S4B syt_ssx1-meis2 1281857 n/a 1281883 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281877 unspecified role unspecified role bait bait association association false false false Fig S4B syt_ssx2-fos-1 1281857 n/a 1281876 unspecified role unspecified role bait bait n/a 1281881 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S4C atf2-meis2 1281857 n/a 1281883 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281873 unspecified role unspecified role bait bait association association false false false Fig S4B/C tle1-meis2 1281857 n/a 1281883 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281875 unspecified role unspecified role bait bait association association false false false Fig S4B/C tle1-egr1-2 1281858 n/a 1281874 unspecified role unspecified role prey prey promoter_region_~100bp_upstream_of_tss binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281875 unspecified role unspecified role bait bait association association false false false Fig 6A, 7A, S7G. Results from HDAC inhibitor-treated SYO-1 cells show the removal of TLE1 from target promoters, whereas SS18-SSX2 and ATF2 remain resident. HDAC inhibitors Romidepsin and SB939. atf2-atf3-1 1281858 n/a 1281873 unspecified role unspecified role bait bait n/a 1281878 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6A, 7A, S7G. syt_ssx2-dus1-1 1281858 n/a 1281880 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281876 unspecified role unspecified role bait bait association association false false false Fig 6A atf3-syt_ssx2-1 1281858 n/a 1281876 unspecified role unspecified role bait bait n/a 1281878 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6A,7A, S7G. atf2-dusp1-1 1281858 n/a 1281873 unspecified role unspecified role bait bait n/a 1281880 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6A atf2-cdnk2a-1 1281858 n/a 1281879 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281873 unspecified role unspecified role bait bait association association false false false Fig 6A tle1-cdnk2a-1 1281858 n/a 1281875 unspecified role unspecified role bait bait n/a 1281879 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6A cdnk2a-syt_ssx2-3 1281858 n/a 1281876 unspecified role unspecified role bait bait n/a 1281879 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6A atf2-egr1-1 1281858 n/a 1281873 unspecified role unspecified role bait bait n/a 1281874 unspecified role unspecified role prey prey promoter_region_~100bp_upstream_of_tss binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6A, 7A, S7G. ssx2-egr1-1 1281858 n/a 1281876 unspecified role unspecified role prey prey n/a 1281874 unspecified role unspecified role prey prey promoter_region_~100bp_upstream_of_tss binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6A, 7A, S7G. tle1-dusp1-1 1281858 n/a 1281875 unspecified role unspecified role bait bait n/a 1281880 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6A tle1-atf3-1 1281858 n/a 1281875 unspecified role unspecified role bait bait n/a 1281878 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6A,7A, S7G. Results from HDAC inhibitor-treated SYO-1 cells show the removal of TLE1 from target promoters, whereas SS18-SSX2 and ATF2 remain resident. HDAC inhibitors Romidepsin and SB939. atf2-nupr1 1281858 n/a 1281882 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281873 unspecified role unspecified role bait bait association association false false false Fig 6A tle1-nupr1-1 1281858 n/a 1281875 unspecified role unspecified role bait bait n/a 1281882 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6A tle1-meis2 1281858 n/a 1281883 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281875 unspecified role unspecified role bait bait association association false false false Fig 6A atf2-meis2-1 1281858 n/a 1281873 unspecified role unspecified role bait bait n/a 1281883 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6A atf2-fos 1281858 n/a 1281873 unspecified role unspecified role bait bait n/a 1281881 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6A tle1-fos 1281858 n/a 1281881 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281875 unspecified role unspecified role bait bait association association false false false Fig 6A syt_ssx2-nupr1 1281858 n/a 1281876 unspecified role unspecified role bait bait n/a 1281882 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6A syt_ssx2-meiss2 1281858 n/a 1281883 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281876 unspecified role unspecified role bait bait association association false false false Fig 6A syt_ssx2-fos 1281858 n/a 1281881 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281876 unspecified role unspecified role bait bait association association false false false Fig 6A egr1-hdac1 1281858 n/a 1281874 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281884 unspecified role unspecified role bait bait association association false false false Fig 7E, 8B. Depletion of TLE1 is associated with a concomitant decrease in HDAC1 and EZH2 occupancy on both EGR1 and ATF3 target promoter regions. HDAC inhibitors Romidepsin, SB939. atf3-hdac1 1281858 n/a 1281878 acceptor acceptor prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281884 acceptor acceptor bait bait association association false false false Depletion of TLE1 is associated with a concomitant decrease in HDAC1 and EZH2 occupancy on both EGR1 and ATF3 target promoter regions. Fig 7E, 8B. HDAC inhibitors Romidepsin, SB939. ezh2-atf3 1281858 n/a 1281878 acceptor acceptor prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281885 acceptor acceptor bait bait association association false false false Depletion of TLE1 is associated with a concomitant decrease in HDAC1 and EZH2 occupancy on both EGR1 and ATF3 target promoter regions. Fig 7E, 8B. HDAC inhibitors Romidepsin, SB939. ezh2-egr1 1281858 n/a 1281885 unspecified role unspecified role bait bait n/a 1281874 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Depletion of TLE1 is associated with a concomitant decrease in HDAC1 and EZH2 occupancy on both EGR1 and ATF3 target promoter regions. Fig 7E, 8B. HDAC inhibitors Romidepsin, SB939. syt_ssx2-egr1 1281859 n/a 1281886 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281876 unspecified role unspecified role bait bait association association false false false Fig 6C, 8E. HDAC inhibitors, Romidepsin and SB939. syt_ssx2-atf3 1281859 n/a 1281887 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281876 unspecified role unspecified role bait bait association association false false false Fig 6C, 8E. HDAC inhibitors, Romidepsin and SB939. atf2-atf3 1281859 n/a 1281888 unspecified role unspecified role bait bait n/a 1281887 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6C, 8E. HDAC inhibitors, Romidepsin and SB939. tle1-atf3-2 1281859 n/a 1281887 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281889 unspecified role unspecified role bait bait association association false false false Fig 6C, 8E. HDAC inhibitors, Romidepsin and SB939. atf2-egr1-1 1281859 n/a 1281886 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281888 unspecified role unspecified role bait bait association association false false false Fig 6C, 8E. HDAC inhibitors, Romidepsin and SB939. tle1-egr1-2 1281859 n/a 1281889 unspecified role unspecified role bait bait n/a 1281886 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6C, 8E. HDAC inhibitors, Romidepsin and SB939. hdac1-atf3-1 1281859 n/a 1281887 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281890 unspecified role unspecified role bait bait association association false false false Fig 7G, 8E. HDAC inhibitors, Romidepsin and SB939. ezh2-atf3 1281859 n/a 1281887 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281891 unspecified role unspecified role bait bait association association false false false Fig 7G, 8E. HDAC inhibitors, Romidepsin and SB939. hdac1-egr1 1281859 n/a 1281890 unspecified role unspecified role bait bait n/a 1281886 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 7G, 8E. HDAC inhibitors, Romidepsin and SB939. ezh2-egr1 1281859 n/a 1281891 unspecified role unspecified role bait bait n/a 1281886 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 7G, 8E. HDAC inhibitors, Romidepsin and SB939. ss18-ssx2-cdkn2a 1281859 n/a 1281876 unspecified role unspecified role bait bait n/a 1281892 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S5B atf2-cdkn2a 1281859 n/a 1281888 unspecified role unspecified role bait bait n/a 1281892 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S5B tle1-cdkn2a 1281859 n/a 1281892 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281889 unspecified role unspecified role bait bait association association false false false Fig S5B tle1-dus1 1281859 n/a 1281889 unspecified role unspecified role bait bait n/a 1281893 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S5B atf2-dus1 1281859 n/a 1281888 unspecified role unspecified role bait bait n/a 1281893 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S5B atf2-fos 1281859 n/a 1281894 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281888 unspecified role unspecified role bait bait association association false false false Fig S5B tle1-fos 1281859 n/a 1281894 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281889 unspecified role unspecified role bait bait association association false false false Fig S5B tle1-meis2 1281859 n/a 1281895 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281889 unspecified role unspecified role bait bait association association false false false Fig S5B atf2-meis2 1281859 n/a 1281895 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281888 unspecified role unspecified role bait bait association association false false false Fig S5B syt18-ssx2-nupre1 1281859 n/a 1281876 unspecified role unspecified role bait bait n/a 1281896 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S5B atf2-nupr1 1281859 n/a 1281896 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281888 unspecified role unspecified role bait bait association association false false false Fig S5B tle1-nupr1 1281859 n/a 1281889 unspecified role unspecified role bait bait n/a 1281896 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S5B syt_ssx2-meis2 1281859 n/a 1281895 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281876 unspecified role unspecified role bait bait association association false false false Fig S5B syt_ssx2-fos 1281859 n/a 1281876 unspecified role unspecified role bait bait n/a 1281894 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S5B syt_ssx2-dus1 1281859 n/a 1281876 unspecified role unspecified role bait bait n/a 1281893 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S5B syt_ssx2-atf2-2 1281860 n/a 1281875 unspecified role unspecified role bait bait n/a 1281876 unspecified role unspecified role prey prey n/a 1281873 unspecified role unspecified role prey prey association association false false false Fig 3A ATF2 and TLE1 coimmunoprecipitation is dependent upon SS18-SSX2. atf2-syt_ssx2-2 1281860 n/a 1281873 unspecified role unspecified role bait bait n/a 1281875 unspecified role unspecified role prey prey n/a 1281876 unspecified role unspecified role prey prey association association false false false Fig 3A ATF2 and TLE1 coimmunoprecipitation is dependent upon SS18-SSX2. atf2-syt_ssx2-1 1281860 n/a 1281873 unspecified role unspecified role prey prey n/a 1281876 unspecified role unspecified role bait bait n/a 1281875 unspecified role unspecified role prey prey association association false false false Fig 1B, 3B. Recruitment of ATF2 and TLE1 to SS18-SSX2 seems to be independent of each other. syt_ssx2-tle1 1281860 n/a 1281876 unspecified role unspecified role bait bait n/a 1281875 unspecified role unspecified role prey prey association association false false false Fig 3B Recruitment of ATF2 and TLE1 to SS18-SSX2 seems to be independent of each other. syt_ssx2-atf2-4 1281860 n/a 1281876 unspecified role unspecified role bait bait n/a 1281873 unspecified role unspecified role prey prey association association false false false Fig 3B Recruitment of ATF2 and TLE1 to SS18-SSX2 seems to be independent of each other. syt_ssx2-atf2-8 1281860 n/a 1281875 unspecified role unspecified role prey prey n/a 1281884 unspecified role unspecified role prey prey n/a 1281885 unspecified role unspecified role prey prey n/a 1281873 unspecified role unspecified role prey prey n/a 1281876 unspecified role unspecified role bait bait association association false false false Fig 7D, 8C. EZH2 ( and HDAC1) interactions are maintained in the absence of ATF2 but require TLE1. HDAC inhibitors Romidepsin, SB939. tle1-ezh2-1 1281860 n/a 1281885 unspecified role unspecified role prey prey n/a 1281875 unspecified role unspecified role bait bait n/a 1281884 unspecified role unspecified role prey prey association association false false false Fig S6C, S7F. hdac1-ezh2-1 1281860 n/a 1281875 unspecified role unspecified role prey prey n/a 1281885 unspecified role unspecified role prey prey n/a 1281884 unspecified role unspecified role bait bait association association false false false Fig S6C ezh2-hdac1-3 1281860 n/a 1281885 unspecified role unspecified role bait bait n/a 1281875 unspecified role unspecified role prey prey n/a 1281884 unspecified role unspecified role prey prey association association false false false Fig S6C eed-atf2 1281860 n/a 1281897 unspecified role unspecified role prey prey n/a 1281898 unspecified role unspecified role bait bait n/a 1281876 unspecified role unspecified role prey prey n/a 1281873 unspecified role unspecified role prey prey n/a 1281884 unspecified role unspecified role prey prey n/a 1281875 unspecified role unspecified role prey prey n/a 1281885 unspecified role unspecified role prey prey association association false false false Fig S6D ezh2-atf2 1281860 n/a 1281876 unspecified role unspecified role prey prey n/a 1281897 unspecified role unspecified role prey prey n/a 1281898 unspecified role unspecified role prey prey n/a 1281873 unspecified role unspecified role prey prey n/a 1281884 unspecified role unspecified role prey prey n/a 1281885 unspecified role unspecified role bait bait n/a 1281875 unspecified role unspecified role prey prey association association false false false Fig S6D suz12-atf2 1281860 n/a 1281875 unspecified role unspecified role prey prey n/a 1281885 unspecified role unspecified role prey prey n/a 1281884 unspecified role unspecified role prey prey n/a 1281873 unspecified role unspecified role prey prey n/a 1281898 unspecified role unspecified role prey prey n/a 1281876 unspecified role unspecified role prey prey n/a 1281897 unspecified role unspecified role bait bait association association false false false Fig S6D tle1-eed 1281860 n/a 1281875 unspecified role unspecified role bait bait n/a 1281885 unspecified role unspecified role prey prey n/a 1281897 unspecified role unspecified role prey prey n/a 1281898 unspecified role unspecified role prey prey association association false false false Fig S6E tle1-eed-1 1281860 n/a 1281898 unspecified role unspecified role prey prey n/a 1281876 unspecified role unspecified role bait bait n/a 1281885 unspecified role unspecified role prey prey n/a 1281897 unspecified role unspecified role prey prey association association false false false Fig S6E atf2-eed 1281860 n/a 1281873 unspecified role unspecified role bait bait n/a 1281897 unspecified role unspecified role prey prey n/a 1281885 unspecified role unspecified role prey prey n/a 1281898 unspecified role unspecified role prey prey association association false false false Fig S6E hdac1-eed-1 1281860 n/a 1281898 unspecified role unspecified role prey prey n/a 1281884 unspecified role unspecified role bait bait n/a 1281885 unspecified role unspecified role prey prey n/a 1281897 unspecified role unspecified role prey prey association association false false false Fig S6E ssxt_ssx2_hum-atf2-4 1281861 n/a 1281888 unspecified role unspecified role prey prey n/a 1281889 unspecified role unspecified role prey prey n/a 1281876 unspecified role unspecified role bait bait association association false false false Fig 1C syt_ssx2-atf2-9 1281861 n/a 1281876 unspecified role unspecified role bait bait n/a 1281891 unspecified role unspecified role prey prey n/a 1281890 unspecified role unspecified role prey prey association association false false false Fig 7H. ezh2-hdac1-4 1281861 n/a 1281890 unspecified role unspecified role prey prey n/a 1281889 unspecified role unspecified role prey prey n/a 1281891 unspecified role unspecified role bait bait association association false false false Fig S6C tle1-ezh2-2 1281861 n/a 1281891 unspecified role unspecified role prey prey n/a 1281889 unspecified role unspecified role bait bait n/a 1281890 unspecified role unspecified role prey prey association association false false false Fig S6C, S7F. hdac1-ezh2-2 1281861 n/a 1281891 unspecified role unspecified role prey prey n/a 1281889 unspecified role unspecified role prey prey n/a 1281890 unspecified role unspecified role bait bait association association false false false Fig S6C tle1-atf2-3 1281861 n/a 1281888 unspecified role unspecified role prey prey n/a 1281889 unspecified role unspecified role bait bait n/a 1281876 unspecified role unspecified role prey prey association association false false false Fig 1C atf2-syt_ssx2-3 1281861 n/a 1281888 unspecified role unspecified role bait bait n/a 1281889 unspecified role unspecified role prey prey n/a 1281876 unspecified role unspecified role prey prey association association false false false Fig 1C ssxt_ssx2--atf2 1281862 n/a 1281876 unspecified role unspecified role bait bait n/a 1281873 unspecified role unspecified role prey prey n/a 1281875 unspecified role unspecified role prey prey association association false false false Fig 1C syt_ssx1-atf2 1281862 n/a 1281877 unspecified role unspecified role bait bait n/a 1281873 unspecified role unspecified role prey prey n/a 1281875 unspecified role unspecified role prey prey association association false false false Fig 1C syt_ssx2-atf2-1 1281862 n/a 1281873 unspecified role unspecified role prey prey n/a 1281875 unspecified role unspecified role bait bait n/a 1281876 unspecified role unspecified role prey prey association association false false false Fig 1C tle1-atf2 1281862 n/a 1281875 unspecified role unspecified role prey prey n/a 1281876 unspecified role unspecified role prey prey n/a 1281873 unspecified role unspecified role bait bait association association false false false Fig 1C syt_ssx1-atf2-1 1281862 n/a 1281877 unspecified role unspecified role prey prey n/a 1281875 unspecified role unspecified role bait bait n/a 1281873 unspecified role unspecified role prey prey association association false false false Fig 1C tle1-atf2-1 1281862 n/a 1281877 unspecified role unspecified role prey prey n/a 1281873 unspecified role unspecified role bait bait n/a 1281875 unspecified role unspecified role prey prey association association false false false Fig 1C syt_ssx2-atf2-5 1281863 n/a 1281873 unspecified role unspecified role prey prey atf2 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281875 unspecified role unspecified role prey prey tle1 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281876 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region_including_snh_domain required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ssxrd_domain required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range false 1282355 1282350 1282356 1282352 association association false false false Fig 3C, 3F. Results suggest that the N-terminal SNH (SYT N-terminal homolog) domain is responsible for the interaction of SS18-SSX2 with ATF2, whereas TLE1 specifically interacts with the repressor domain (SSXRD) of SS18-SSX2. syt_ssx2-atf2-6 1281863 n/a 1281899 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281873 unspecified role unspecified role prey prey physical association physical association false false false Fig 3C tle1-atf2 1281863 n/a 1281875 unspecified role unspecified role bait bait n/a 1281873 unspecified role unspecified role prey prey n/a 1281876 unspecified role unspecified role prey prey ssxrd_domain required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 3F. Results suggest that the N-terminal SNH (SYT N-terminal homolog) domain is responsible for the interaction of SS18-SSX2 with ATF2, whereas TLE1 specifically interacts with the repressor domain (SSXRD) of SS18-SSX2. ATF2 does not bind to TLE1 in the absence of the SNH domain of SS18-SSX2. atf2-tle1 1281863 n/a 1281876 unspecified role unspecified role prey prey region_including_snh_domain required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281873 unspecified role unspecified role bait bait n/a 1281875 unspecified role unspecified role prey prey association association false false false Fig 3F. Results suggest that the N-terminal SNH (SYT N-terminal homolog) domain is responsible for the interaction of SS18-SSX2 with ATF2, whereas TLE1 specifically interacts with the repressor domain (SSXRD) of SS18-SSX2. TLE1 does not bind to ATF2 in the absence of the SSSRD domain of SS18-SSX2. cre-atf2 1281864 n/a 1281900 unspecified role unspecified role bait bait 5-prime_infrared_dye_700 tag tag certain certain sequence position certain certain certain sequence position certain false n/a 1281876 unspecified role unspecified role prey prey association association false false false Fig 5E cre-atf2-1 1281864 n/a 1281876 unspecified role unspecified role prey prey n/a 1281900 unspecified role unspecified role bait bait 5-prime_infrared_dye_700 tag tag certain certain sequence position certain certain certain sequence position certain false n/a 1281873 unspecified role unspecified role prey prey association association false false false Fig 5E cre-syt_ssx2-2 1281864 n/a 1281875 unspecified role unspecified role prey prey n/a 1281876 unspecified role unspecified role prey prey n/a 1281900 unspecified role unspecified role bait bait 5-prime_infrared_dye_700 tag tag certain certain sequence position certain certain certain sequence position certain false association association false false false Fig 5E tle1-hdac1 1281865 n/a 1281885 unspecified role unspecified role prey prey n/a 1281884 unspecified role unspecified role prey prey n/a 1281875 unspecified role unspecified role bait bait association association false false false Fig 7F hdac1-ezh2 1281865 n/a 1281885 unspecified role unspecified role prey prey n/a 1281875 unspecified role unspecified role prey prey n/a 1281884 unspecified role unspecified role bait bait association association false false false Fig 7F ezh2-hdac1 1281865 n/a 1281884 unspecified role unspecified role prey prey n/a 1281875 unspecified role unspecified role prey prey n/a 1281885 unspecified role unspecified role bait bait association association false false false Fig 7F tle1-hdac1-1 1281866 n/a 1281890 unspecified role unspecified role prey prey n/a 1281889 unspecified role unspecified role bait bait n/a 1281891 unspecified role unspecified role prey prey association association false false false Fig 7F tle1-ezh2 1281866 n/a 1281890 unspecified role unspecified role prey prey n/a 1281891 unspecified role unspecified role bait bait n/a 1281889 unspecified role unspecified role prey prey association association false false false Fig 7F ezh2-hdac1-2 1281866 n/a 1281890 unspecified role unspecified role bait bait n/a 1281891 unspecified role unspecified role prey prey n/a 1281889 unspecified role unspecified role prey prey association association false false false Fig 7F ss18-atf2 1281867 n/a 1281899 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281873 unspecified role unspecified role bait bait association association false false false Fig S3B Tle1 is not precipitated in the absence of the SS18-SSX fusion protein. syt_ssx1-atf2-3 1281867 n/a 1281875 unspecified role unspecified role prey prey n/a 1281873 unspecified role unspecified role bait bait n/a 1281877 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S3C atf2-syt_ssx1 1281867 n/a 1281873 unspecified role unspecified role prey prey n/a 1281875 unspecified role unspecified role bait bait n/a 1281877 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S3C syt_ssx2-atf2-10 1281868 n/a 1281901 unspecified role unspecified role prey prey n/a 1281902 unspecified role unspecified role prey prey n/a 1281873 unspecified role unspecified role prey prey n/a 1281875 unspecified role unspecified role prey prey n/a 1281876 unspecified role unspecified role bait bait n/a 1281898 unspecified role unspecified role prey prey n/a 1281903 unspecified role unspecified role prey prey n/a 1281897 unspecified role unspecified role prey prey n/a 1281885 unspecified role unspecified role prey prey n/a 1281884 unspecified role unspecified role prey prey association association false false false Fig 1A, S1C. ssxt_ssx2_hum-atf2-5 1281869 n/a 1281901 unspecified role unspecified role neutral component neutral component n/a 1281876 unspecified role unspecified role neutral component neutral component n/a 1281875 unspecified role unspecified role neutral component neutral component n/a 1281884 unspecified role unspecified role neutral component neutral component n/a 1281885 unspecified role unspecified role neutral component neutral component n/a 1281873 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 1D, S1G, 3D, 8D. ATF2 and TLE1 migrate as individual glycerol-gradient peaks in SS18-SSX2-knockdown cells. HDAC inhibitor, Romidepsin. SS18-SSX2 and TLE1 are located in two separate elution peaks after Romidepsin treatment. cre-syt_ssx2 1281870 n/a 1281900 unspecified role unspecified role bait bait 5-prime_infrared_dye_700 tag tag certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1281876 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 5D syt_ssx1-atf2-2 1281871 n/a 1281875 unspecified role unspecified role prey prey n/a 1281877 unspecified role unspecified role bait bait n/a 1281873 unspecified role unspecified role prey prey association association false false false Fig S1D ssxt_ssx2_hum-atf2-6 1281872 n/a 1281875 unspecified role unspecified role neutral component neutral component n/a 1281876 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281873 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig S3D ATF2 and TLE1 migrate as individual glycerol-gradient peaks in the absence of (myc)-SS18-SSX2.