I2D I2D khanal-2012-1 Proyl isomerase Pin1 facilitates ubiquitin-mediated degradation of cyclin-dependent kinase 10 to induce tamoxifen resistance in breast cancer cells. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Khanal P., Yun H.J., Lim S.C., Ahn S.G., Yoon H.E., Kang K.W., Hong R., Choi H.S. Cancer - Interactions investigated in the context of cancer Author confirms that Pin1-Wt, WW, PPIase, CDK and mutant constructs are all human. Pin1S16A construct is mouse. chs@chosun.ac.kr Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database khanal-2012-3 Proyl isomerase Pin1 facilitates ubiquitin-mediated degradation of cyclin-dependent kinase 10 to induce tamoxifen resistance in breast cancer cells. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Khanal P., Yun H.J., Lim S.C., Ahn S.G., Yoon H.E., Kang K.W., Hong R., Choi H.S. Cancer - Interactions investigated in the context of cancer Author confirms that Pin1-Wt, WW, PPIase, CDK and mutant constructs are all human. Pin1S16A construct is mouse. chs@chosun.ac.kr Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database khanal-2012-2 Proyl isomerase Pin1 facilitates ubiquitin-mediated degradation of cyclin-dependent kinase 10 to induce tamoxifen resistance in breast cancer cells. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Khanal P., Yun H.J., Lim S.C., Ahn S.G., Yoon H.E., Kang K.W., Hong R., Choi H.S. Cancer - Interactions investigated in the context of cancer Author confirms that Pin1-Wt, WW, PPIase, CDK and mutant constructs are all human. Pin1S16A construct is mouse. chs@chosun.ac.kr Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database cdk10_human Cyclin-dependent kinase 10 CDK10 Serine/threonine-protein kinase PISSLRE Cell division protein kinase 10 protein protein human Homo sapiens Human MAEPDLECEQIRLKCIRKEGFFTVPPEHRLGRCRSVKEFEKLNRIGEGTYGIVYRARDTQTDEIVALKKVRMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQVKCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVKPMTPKVVTLWYRAPELLLGTTTQTTSIDMWAVGCILAELLAHRPLLPGTSEIHQIDLIVQLLGTPSENIWPGFSKLPLVGQYSLRKQPYNNLKHKFPWLSEAGLRLLHFLFMYDPKKRATAGDCLESSYFKEKPLPCEPELMPTFPHHRNKRAAPATSEGQSKRCKP pin1_human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Rotamase Pin1 Peptidyl-prolyl cis-trans isomerase Pin1 PIN1 protein protein human Homo sapiens Human MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE pin1_mouse Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Pin1 Peptidyl-prolyl cis-trans isomerase Pin1 protein protein mouse Mus musculus Mouse MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGSTVGGSSKNGQGEPAKVRCSHLLVKHSQSRRPSSWRQEKITRSKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGPFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE cdk10-pin1-1 1315310 n/a 1315313 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1315314 unspecified role unspecified role prey prey xpress-tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2b pin1-cdk10 1315310 n/a 1315314 unspecified role unspecified role bait bait xpress-tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1315313 unspecified role unspecified role prey prey region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2b, d pin1-cdk10-1 1315310 n/a 1315313 unspecified role unspecified role prey prey region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1315315 unspecified role unspecified role bait bait Q9QUR7:p.Ser16Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false xpress-tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2d pin1-cdk10-3 1315311 n/a 1315313 unspecified role unspecified role prey prey n/a 1315314 unspecified role unspecified role bait bait physical association physical association false false false 2h Pin1 and CDK10 interaction occurs after stimulation of MCF7 cells with 10% FBS for 4h after starvation. cdk10-pin1-2 1315311 n/a 1315314 unspecified role unspecified role prey prey n/a 1315313 unspecified role unspecified role bait bait physical association physical association false false false 2h Pin1 and CDK10 interaction occurs after stimulation of MCF7 cells with 10% FBS for 4h after starvation. pin1-cdk10-2 1315312 n/a 1315313 unspecified role unspecified role prey prey region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q15131:p.Thr133Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 1315314 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2f, g Increasing amounts of calf intestine alkaline phosphatase resulted in decreasing interaction between Pin1 and CDK10.