I2D I2D vesuna-2011-3 Twist contributes to hormone resistance in breast cancer by downregulating estrogen receptor-α human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Vesuna F., Lisok A., Kimble B., Domek J., Kato Y., van der Groep P., Artemov D., Kowalski J., Carraway H., van Diest P., Raman V. Cancer - Interactions investigated in the context of cancer vraman2@jhmi.edu, fvesuna1@jhmi.edu Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database vesuna-2011-1 Twist contributes to hormone resistance in breast cancer by downregulating estrogen receptor-α human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Vesuna F., Lisok A., Kimble B., Domek J., Kato Y., van der Groep P., Artemov D., Kowalski J., Carraway H., van Diest P., Raman V. Cancer - Interactions investigated in the context of cancer vraman2@jhmi.edu, fvesuna1@jhmi.edu Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database vesuna-2011-2 Twist contributes to hormone resistance in breast cancer by downregulating estrogen receptor-α human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Vesuna F., Lisok A., Kimble B., Domek J., Kato Y., van der Groep P., Artemov D., Kowalski J., Carraway H., van Diest P., Raman V. Cancer - Interactions investigated in the context of cancer vraman2@jhmi.edu, fvesuna1@jhmi.edu Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database eralpha_human_gene Human estrogen receptor alpha gene gene human Homo sapiens Human twst1_human Twist-related protein 1 H-twist TWIST1 TWIST BHLHA38 Class A basic helix-loop-helix protein 38 protein protein human Homo sapiens Human MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA dnm3b_human DNA (cytosine-5)-methyltransferase 3B DNMT3B DNA methyltransferase HsaIIIB protein protein human Homo sapiens Human MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRETRTRSESPAVRTRNNNSVSSRERHRPSPRSTRGRQGRNHVDESPVEFPATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGTPQSSSTPYARLAQDSQQGGMESPQVEADSGDGDSSEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKPNNTQPVVNKSKVRRAGSRKLESRKYENKTRRRTADDSATSDYCPAPKRLKTNCYNNGKDRGDEDQSREQMASDVANNKSSLEDGCLSCGRKNPVSFHPLFEGGLCQTCRDRFLELFYMYDDDGYQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGTGTAAEAKLQEPWSCYMCLPQRCHGVLRRRKDWNVRLQAFFTSDTGLEYEAPKLYPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKVGKYVASEVCEESIAVGTVKHEGNIKYVNDVRNITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLECNPVMIDAIKVSAAHRARYFWGNLPGMNRPVIASKNDKLELQDCLEYNRIAKLKKVQTITTKSNSIKQGKNQLFPVVMNGKEDVLWCTELERIFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE eralpha-twist1-1 1281454 n/a 1281457 unspecified role unspecified role prey prey promoter-e_boxes binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281458 unspecified role unspecified role bait bait association association false false false 1f hdac1-eralpha 1281454 n/a 1281459 unspecified role unspecified role bait bait n/a 1281457 unspecified role unspecified role prey prey promoter-e_boxes binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5m dnmt3b-eralpha-2 1281454 n/a 1281457 unspecified role unspecified role prey prey promoter-e_boxes binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281460 unspecified role unspecified role bait bait association association false false false 5m dnmt3b-hdac1 1281455 n/a 1281459 unspecified role unspecified role prey prey n/a 1281458 unspecified role unspecified role bait bait n/a 1281460 unspecified role unspecified role prey prey physical association physical association false false false 5i eralpha-twist1 1281456 n/a 1281457 unspecified role unspecified role prey prey promoter-e_boxes binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281458 unspecified role unspecified role bait bait association association false false false 1e