I2D I2D kim-2011e-1 Cancer cells promote survival through depletion of the von Hippel-Lindau tumor suppressor by protein crosslinking. human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim D.S., Choi Y.B., Han B.G., Park S.Y., Jeon Y., Kim D.H., Ahn E.R., Shin J.E., Lee B.I., Lee H., Hong K.M., Kim S.Y. Cancer - Interactions investigated in the context of cancer Author confirms that HA-VHL is of human origin. kimsooyoul@gmail.com Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database kim-2011e-2 Cancer cells promote survival through depletion of the von Hippel-Lindau tumor suppressor by protein crosslinking. human-nci-adr-res Human ovarian adenocarcinoma nci-adr-res Human ovarian adenocarcinoma NCI/ADR-RES cells were originally thought to be Multidrug-resistant MCF-7 breast adenocarcinoma cells (originally named MCF-7/AdrR cells) until SNP sequencing revealed they are derivatives of OVCAR-8 cells. NCI/ADR-RES cells were originally thought to be Multidrug-resistant MCF-7 breast adenocarcinoma cells (originally named MCF-7/AdrR cells) until SNP sequencing revealed they are derivatives of OVCAR-8 cells. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim D.S., Choi Y.B., Han B.G., Park S.Y., Jeon Y., Kim D.H., Ahn E.R., Shin J.E., Lee B.I., Lee H., Hong K.M., Kim S.Y. Cancer - Interactions investigated in the context of cancer Author confirms that HA-VHL is of human origin. kimsooyoul@gmail.com Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database kim-2011e-3 Cancer cells promote survival through depletion of the von Hippel-Lindau tumor suppressor by protein crosslinking. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kim D.S., Choi Y.B., Han B.G., Park S.Y., Jeon Y., Kim D.H., Ahn E.R., Shin J.E., Lee B.I., Lee H., Hong K.M., Kim S.Y. Cancer - Interactions investigated in the context of cancer Author confirms that HA-VHL is of human origin. kimsooyoul@gmail.com Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database kim-2011e-4 Cancer cells promote survival through depletion of the von Hippel-Lindau tumor suppressor by protein crosslinking. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kim D.S., Choi Y.B., Han B.G., Park S.Y., Jeon Y., Kim D.H., Ahn E.R., Shin J.E., Lee B.I., Lee H., Hong K.M., Kim S.Y. Cancer - Interactions investigated in the context of cancer Author confirms that HA-VHL is of human origin. kimsooyoul@gmail.com Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database kim-2011e-5 Cancer cells promote survival through depletion of the von Hippel-Lindau tumor suppressor by protein crosslinking. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kim D.S., Choi Y.B., Han B.G., Park S.Y., Jeon Y., Kim D.H., Ahn E.R., Shin J.E., Lee B.I., Lee H., Hong K.M., Kim S.Y. Cancer - Interactions investigated in the context of cancer Author confirms that HA-VHL is of human origin. kimsooyoul@gmail.com Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database kim-2011e-6 Cancer cells promote survival through depletion of the von Hippel-Lindau tumor suppressor by protein crosslinking. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kim D.S., Choi Y.B., Han B.G., Park S.Y., Jeon Y., Kim D.H., Ahn E.R., Shin J.E., Lee B.I., Lee H., Hong K.M., Kim S.Y. Cancer - Interactions investigated in the context of cancer Author confirms that HA-VHL is of human origin. kimsooyoul@gmail.com Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database kim-2011e-7 Cancer cells promote survival through depletion of the von Hippel-Lindau tumor suppressor by protein crosslinking. in vitro In vitro enzymatic study enzymatic study weight by staining molecular weight estimation by staining weight by staining Kim D.S., Choi Y.B., Han B.G., Park S.Y., Jeon Y., Kim D.H., Ahn E.R., Shin J.E., Lee B.I., Lee H., Hong K.M., Kim S.Y. Cancer - Interactions investigated in the context of cancer Author confirms that HA-VHL is of human origin. kimsooyoul@gmail.com Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database kim-2011e-8 Cancer cells promote survival through depletion of the von Hippel-Lindau tumor suppressor by protein crosslinking. in vitro In vitro enzymatic study enzymatic study sequence tag sequence tag identification sequence tag Kim D.S., Choi Y.B., Han B.G., Park S.Y., Jeon Y., Kim D.H., Ahn E.R., Shin J.E., Lee B.I., Lee H., Hong K.M., Kim S.Y. Cancer - Interactions investigated in the context of cancer Author confirms that HA-VHL is of human origin. kimsooyoul@gmail.com Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database kim-2011e-9 Cancer cells promote survival through depletion of the von Hippel-Lindau tumor suppressor by protein crosslinking. in vitro In vitro enzymatic study enzymatic study western blot western blot Immuno blot Immuno blot Kim D.S., Choi Y.B., Han B.G., Park S.Y., Jeon Y., Kim D.H., Ahn E.R., Shin J.E., Lee B.I., Lee H., Hong K.M., Kim S.Y. Cancer - Interactions investigated in the context of cancer Author confirms that HA-VHL is of human origin. kimsooyoul@gmail.com Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database vhl_human von Hippel-Lindau disease tumor suppressor VHL pVHL Protein G7 protein protein human Homo sapiens Human MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD tgm2_human Protein-glutamine gamma-glutamyltransferase 2 TGM2 Tissue transglutaminase Transglutaminase C Transglutaminase-2 Transglutaminase H Erythrocyte transglutaminase Heart G alpha(h) Isopeptidase TGM2 Protein G alpha(h) Protein-glutamine deamidase TGM2 Protein-glutamine dopaminyltransferase TGM2 Protein-glutamine histaminyltransferase TGM2 Protein-glutamine noradrenalinyltransferase TGM2 Protein-glutamine serotonyltransferase TGM2 Transglutaminase II protein protein human Homo sapiens Human MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLEASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPWNFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGRWDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPTPQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSLIVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVGQSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEKSVPLCILYEKYRDCLTESNLIKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQKRKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLPLHMGLHKLVVNFESDKLKAVKGFRNVIIGPA tgm2_cavcu Protein-glutamine gamma-glutamyltransferase 2 Tissue transglutaminase Transglutaminase-2 TGM2 Guinea pig liver transglutaminase Isopeptidase TGM2 Protein-glutamine deamidase TGM2 Protein-glutamine dopaminyltransferase TGM2 Protein-glutamine histaminyltransferase TGM2 Protein-glutamine noradrenalinyltransferase TGM2 Protein-glutamine serotonyltransferase TGM2 protein protein cavcu Cavia cutleri (Guinea pig) MAEDLILERCDLQLEVNGRDHRTADLCRERLVLRRGQPFWLTLHFEGRGYEAGVDTLTFNAVTGPDPSEEAGTMARFSLSSAVEGGTWSASAVDQQDSTVSLLLSTPADAPIGLYRLSLEASTGYQGSSFVLGHFILLYNPRCPADAVYMDSDQERQEYVLTQQGFIYQGSAKFINGIPWNFGQFEDGILDICLMLLDTNPKFLKNAGQDCSRRSRPVYVGRVVSAMVNCNDDQGVLQGRWDNNYSDGVSPMSWIGSVDILRRWKDYGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTNFNSAHDQNSNLLIEYFRNESGEIEGNKSEMIWNFHCWVESWMTRPDLEPGYEGWQALDPTPQEKSEGTYCCGPVPVRAIKEGHLNVKYDAPFVFAEVNADVVNWIRQKDGSLRKSINHLVVGLKISTKSVGRDEREDITHTYKYPEGSEEEREAFVRANHLNKLATKEEAQEETGVAMRIRVGQNMTMGSDFDIFAYITNGTAESHECQLLLCARIVSYNGVLGPVCSTNDLLNLTLDPFSENSIPLHILYEKYGDYLTESNLIKVRGLLIEPAANSYVLAERDIYLENPEIKIRVLGEPKQNRKLIAEVSLKNPLPVPLLGCIFTVEGAGLTKDQKSVEVPDPVEAGEQAKVRVDLLPTEVGLHKLVVNFECDKLKAVKGYRNVIIGPA vhl-tgm2 1245761 n/a 1245770 unspecified role unspecified role bait bait n/a 1245771 unspecified role unspecified role prey prey physical association physical association false false false 2b tgm2-vhl-4 1245761 n/a 1245770 unspecified role unspecified role prey prey n/a 1245771 unspecified role unspecified role bait bait physical association physical association false false false 2b vhl-tgm2-1 1245762 n/a 1245770 unspecified role unspecified role bait bait n/a 1245771 unspecified role unspecified role prey prey physical association physical association false false false 2b tgm2-vhl-5 1245762 n/a 1245771 unspecified role unspecified role bait bait n/a 1245770 unspecified role unspecified role prey prey physical association physical association false false false 2b vhl-tgm2-2 1245763 n/a 1245770 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1245771 unspecified role unspecified role prey prey physical association physical association false false false 3b MG132 tgm2-vhl 1245764 n/a 1245770 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1245771 unspecified role unspecified role bait bait physical association physical association false false false 3b MG132 tgm2-vhl-1 1245765 n/a 1245770 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1245771 unspecified role unspecified role bait bait physical association physical association false false false 3b MG132 vhl-tgm2-3 1245766 n/a 1245771 unspecified role unspecified role prey prey n/a 1245770 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3b MG132 tgm2-vhl-6 1245767 n/a 1245771 enzyme enzyme neutral component neutral component n/a 1245770 enzyme target enzyme target substrate substrate neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) transglutamination transglutamination reaction transglutamination false false false 4a, c TGase 2 induced the polymerization of VHL. tgm2-vhl-7 1245768 n/a 1245770 enzyme target enzyme target substrate substrate neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1245772 enzyme enzyme neutral component neutral component transglutamination transglutamination reaction transglutamination false false false Fig 4 tgm2-vhl-8 1245769 n/a 1245770 enzyme target enzyme target substrate substrate neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1245771 enzyme enzyme neutral component neutral component P21980:p.Cys277Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false transglutamination transglutamination reaction transglutamination false false false 4a, c TGase 2 induced the polymerization of VHL.