I2D I2D rodriguez-2011-2 Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 pull down pull down anti tag western anti tag western blot anti tag western Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database rodriguez-2011-3 Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. human-a375 Human malignant melanoma a375 Human malignant melanoma ATCC catalog # CRL-1872 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database rodriguez-2011-4 Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. human-g361 Human malignant melanoma g361 Human malignant melanoma ATCC catalog # CRL1424 ATCC catalog # CRL-1424 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database rodriguez-2011-5 Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database rodriguez-2011-6 Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. human-sk_mel_28 Homo sapiens SK-MEL-28 cell line derived from melanoma sk_mel_28 human SK-MEL-28 Species: human male 51 years old; Tissue: skin; Tumor: melanoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database rodriguez-2011-1 Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. in vitro In vitro adp ribosylase adp ribosylase assay adp ribosylase autoradiography autoradiography Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database rodriguez-2011-7 Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. human-a375 Human malignant melanoma a375 Human malignant melanoma ATCC catalog # CRL-1872 confocal microscopy confocal microscopy immunostaining immunostaining Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database rodriguez-2011-8 Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. human-g361 Human malignant melanoma g361 Human malignant melanoma ATCC catalog # CRL1424 ATCC catalog # CRL-1424 confocal microscopy confocal microscopy immunostaining immunostaining Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database parp1_human Poly [ADP-ribose] polymerase 1 PARP1 ADPRT PPOL NAD(+) ADP-ribosyltransferase 1 Poly[ADP-ribose] synthase 1 ADP-ribosyltransferase diphtheria toxin-like 1 DNA ADP-ribosyltransferase PARP1 Protein poly-ADP-ribosyltransferase PARP1 protein protein human Homo sapiens Human MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW snai1_mouse Zinc finger protein SNAI1 Snai1 Sna Protein snail homolog 1 protein protein mouse Mus musculus Mouse MPRSFLVRKPSDPRRKPNYSELQDACVEFTFQQPYDQAHLLAAIPPPEVLNPAASLPTLIWDSLLVPQVRPVAWATLPLRESPKAVELTSLSDEDSGKSSQPPSPPSPAPSSFSSTSASSLEAEAFIAFPGLGQLPKQLARLSVAKDPQSRKIFNCKYCNKEYLSLGALKMHIRSHTLPCVCTTCGKAFSRPWLLQGHVRTHTGEKPFSCSHCNRAFADRSNLRAHLQTHSDVKRYQCQACARTFSRMSLLHKHQESGCSGGPR snai1_human Zinc finger protein SNAI1 Protein snail homolog 1 SNAI1 SNAH protein protein human Homo sapiens Human MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR parp1-snai1-1 1243814 n/a 1243822 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 1243823 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4a, b, f, i KU0058948 LiCl parp1-snai1-4 1243814 n/a 1243822 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1243823 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Minimal binding of PARP-1 is seen with the N-terminal region of Snail1. physical association physical association false false false 4g snai1-parp1 1243815 n/a 1243824 unspecified role unspecified role bait bait n/a 1243822 unspecified role unspecified role prey prey physical association physical association false false false 4c parp1-snai1-3 1243815 n/a 1243822 unspecified role unspecified role bait bait n/a 1243824 unspecified role unspecified role prey prey physical association physical association false false false 4c, e KU0058948 TGF-Beta Doxorubicin parp1-snai1-2 1243816 n/a 1243824 unspecified role unspecified role prey prey n/a 1243822 unspecified role unspecified role bait bait physical association physical association false false false 4c snai1-parp1-1 1243816 n/a 1243822 unspecified role unspecified role prey prey n/a 1243824 unspecified role unspecified role bait bait physical association physical association false false false 4c snai1-parp1-2 1243817 n/a 1243824 unspecified role unspecified role bait bait n/a 1243822 unspecified role unspecified role prey prey physical association physical association false false false S2d parp1-snai1-5 1243817 n/a 1243824 unspecified role unspecified role prey prey n/a 1243822 unspecified role unspecified role bait bait physical association physical association false false false S2d snai1-parp1-3 1243818 n/a 1243822 unspecified role unspecified role prey prey n/a 1243824 unspecified role unspecified role bait bait physical association physical association false false false S2d parp1-snai1-6 1243818 n/a 1243822 unspecified role unspecified role bait bait n/a 1243824 unspecified role unspecified role prey prey physical association physical association false false false S2d parp1-snai1-8 1243819 n/a 1243822 enzyme enzyme neutral component neutral component spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection n/a 1243823 enzyme target enzyme target substrate substrate neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 adp ribosylation adp ribosylation reaction adp ribosylation false false false 3a parp1-snai1-7 1243820 n/a 1243822 unspecified role unspecified role neutral component neutral component n/a 1243824 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4d, S2c KU00058948 PJ-34 parp1-snai1-8 1243821 n/a 1243824 unspecified role unspecified role neutral component neutral component n/a 1243822 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false S2c KU00058948 PJ-34