I2D I2D walker-2011-2 RAC3 is a pro-migratory co-activator of ERα. in vitro In vitro phage display phage display nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Walker MP., Zhang M., Le TP., Wu P., Laine M., Greene GL. Apoptosis - Interactions involving proteins with a function related to apoptosis Author confirms that His-Rac3 is human. ggreene@uchicago.edu Human breast cDNA library (Novagen). Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer walker-2011-4 RAC3 is a pro-migratory co-activator of ERα. human-mcf7-c4-12 Human ERalpha-negative mammary adenocarcinoma cells mcf7-c4-12 Estrogen Receptor alpha- negative mammary gland adenocarcinoma cells 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Walker MP., Zhang M., Le TP., Wu P., Laine M., Greene GL. Apoptosis - Interactions involving proteins with a function related to apoptosis MCF7-C4-12 cells were seeded in 48-well dishes and transfected with equal amounts of pSG-5 luciferase, GAL-4 vector, VP-16 ERalpha and RTK using Lipofectamine 2000 (Invitrogen). Plates were read using a dual luciferase protocol (Hampf and Gossen, 2006) on a Wallac Microbeta Jet Luminometer. Author confirms that His-Rac3 is human. ggreene@uchicago.edu Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer walker-2011-3 RAC3 is a pro-migratory co-activator of ERα. human-mcf7-c4-12 Human ERalpha-negative mammary adenocarcinoma cells mcf7-c4-12 Estrogen Receptor alpha- negative mammary gland adenocarcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Walker MP., Zhang M., Le TP., Wu P., Laine M., Greene GL. Apoptosis - Interactions involving proteins with a function related to apoptosis Cells were treated with 10nM Estradiol for 1hr Author confirms that His-Rac3 is human. ggreene@uchicago.edu Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer walker-2011-1 RAC3 is a pro-migratory co-activator of ERα. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Walker MP., Zhang M., Le TP., Wu P., Laine M., Greene GL. Apoptosis - Interactions involving proteins with a function related to apoptosis Author confirms that His-Rac3 is human. ggreene@uchicago.edu Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer esr1_human Estrogen receptor ESR1 ESR NR3A1 Estradiol receptor ER-alpha Nuclear receptor subfamily 3 group A member 1 protein protein human Homo sapiens Human MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV rac3_human Ras-related C3 botulinum toxin substrate 3 p21-Rac3 RAC3 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF asf1a_human Histone chaperone ASF1A Anti-silencing function protein 1 homolog A CCG1-interacting factor A ASF1A CGI-98 HSPC146 protein protein human Homo sapiens Human MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSENSLNVMLESHMDCM This sequence has been withdrawn from Uniprot. atf1_human Cyclic AMP-dependent transcription factor ATF-1 Activating transcription factor 1 Protein TREB36 ATF1 protein protein human Homo sapiens Human MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILARRPSYRKILKDLSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQLASPGTDGVQGLQTLTMTNSGSTQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYSNKSV blcap_human Bladder cancer-associated protein BLCAP BC10 Bladder cancer 10 kDa protein protein protein human Homo sapiens Human MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGT dnm1l_human Dynamin-1-like protein Dynamin-like protein Dnm1p/Vps1p-like protein Dynamin family member proline-rich carboxyl-terminal domain less Dynamin-related protein 1 Dynamin-like protein 4 Dynamin-like protein IV DNM1L DLP1 DRP1 protein protein human Homo sapiens Human MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLIQDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW F9521A376B785B71 hax1_human HCLS1-associated protein X-1 HAX1 HS1BP1 HS1-associating protein X-1 HS1-binding protein 1 protein protein human Homo sapiens Human MSLFDLFRGFFGFPGPRSHRDPFFGGMTRDEDDDEEEEEEGGSWGRGNPRFHSPQHPPEEFGFGFSFSPGGGIRFHDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGLGPVLQPQPKSYFKSISVTKITKPDGIVEERRTVVDSEGRTETTVTRHEADSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR myl6_human Myosin light polypeptide 6 MYL6 Smooth muscle and nonmuscle myosin light chain alkali 6 Myosin light chain alkali 3 Myosin light chain 3 17 kDa myosin light chain protein protein human Homo sapiens Human MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG ndrg2_human Protein NDRG2 NDRG2 KIAA1248 SYLD Protein Syld709613 N-myc downstream-regulated gene 2 protein protein protein human Homo sapiens Human MAELQEVQITEEKPLLPGQTPEAAKEAELAARILLDQGQTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC senp5_human Sentrin-specific protease 5 SENP5 Sentrin/SUMO-specific protease SENP5 FKSG45 protein protein human Homo sapiens Human MKKQRKILWRKGIHLAFSEKWNTGFGGFKKFYFHQHLCILKAKLGRPVTWNRQLRHFQGRKKALQIQKTWIKDEPLCAKTKFNVATQNVSTLSSKVKRKDAKHFISSSKTLLRLQAEKLLSSAKNSDHEYCREKNLLKAVTDFPSNSALGQANGHRPRTDPQPSDFPMKFNGESQSPGESGTIVVTLNNHKRKGFCYGCCQGPEHHRNGGPLIPKKFQLNQHRRIKLSPLMMYEKLSMIRFRYRILRSQHFRTKSKVCKLRKAQRSWVQKVTGDHQETRRENGEGGSCSPFPSPEPKDPSCRHQPYFPDMDSSAVVKGTNSHVPDCHTKGSSFLGKELSLDEAFPDQQNGSATNAWDQSSCSSPKWECTELIHDIPLPEHRSNTMFISETEREIMTLGQENQTSSVSDDRVKLSVSGADTSVSSVDGPVSQKAVQNENSYQMEEDGSLKQSILSSELLDHPYCKSPLEAPLVCSGLKLENQVGGGKNSQKASPVDDEQLSVCLSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYRARHQKCNFRIFYNKHMLDMDDLATLDGQNWLNDQVINMYGELIMDAVPDKVHFFNSFFHRQLVTKGYNGVKRWTKKVDLFKKSLLLIPIHLEVHWSLITVTLSNRIISFYDSQGIHFKFCVENIRKYLLTEAREKNRPEFLQGWQTAVTKCIPQQKNDSDCGVFVLQYCKCLALEQPFQFSQEDMPRVRKRIYKELCECRLMD edf1_human Endothelial differentiation-related factor 1 Multiprotein-bridging factor 1 EDF1 protein protein human Homo sapiens Human MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK esr1-rac3 1144724 n/a 1144728 unspecified role unspecified role bait bait n/a 1144729 unspecified role unspecified role prey prey direct interaction direct interaction false false false esr1-asf1a 1144724 n/a 1144730 unspecified role unspecified role prey prey n/a 1144728 unspecified role unspecified role bait bait direct interaction direct interaction false false false Supplementary Table 1 esr1-atf1 1144724 n/a 1144728 unspecified role unspecified role bait bait n/a 1144731 unspecified role unspecified role prey prey direct interaction direct interaction false false false Supplementary Table 1 esr1-blcap 1144724 n/a 1144728 unspecified role unspecified role bait bait n/a 1144732 unspecified role unspecified role prey prey direct interaction direct interaction false false false Supplementary Table 1 esr1-dnm1l 1144724 n/a 1144728 unspecified role unspecified role bait bait n/a 1144733 unspecified role unspecified role prey prey direct interaction direct interaction false false false Supplementary Table 1 esr1-hax1 1144724 n/a 1144734 unspecified role unspecified role prey prey n/a 1144728 unspecified role unspecified role bait bait direct interaction direct interaction false false false Supplementary Table 1 esr1-myl6 1144724 n/a 1144735 unspecified role unspecified role prey prey n/a 1144728 unspecified role unspecified role bait bait direct interaction direct interaction false false false Supplementary Table 1 esr1-ndrg2 1144724 n/a 1144728 unspecified role unspecified role bait bait n/a 1144736 unspecified role unspecified role prey prey direct interaction direct interaction false false false Supplementary Table 1 esr1-senp5 1144724 n/a 1144728 unspecified role unspecified role bait bait n/a 1144737 unspecified role unspecified role prey prey direct interaction direct interaction false false false Supplementary Table 1 esr1-edf1 1144724 n/a 1144728 unspecified role unspecified role bait bait n/a 1144738 unspecified role unspecified role prey prey direct interaction direct interaction false false false Supplementary Table 1 esr1-rac3-2 1144725 n/a 1144728 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region vp16 ad vp16 activation domain vp16 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1144729 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1c Rac3 interacts with ERalpha in the presence of 10nM Estradiol. Author confirms that Gal4-Rac3 is human. esr1-asf1a-1 1144725 n/a 1144730 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1144728 unspecified role unspecified role bait bait region vp16 ad vp16 activation domain vp16 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false ASF1A interacts with ERalpha in the presence of 10nM Estradiol. Supplemental Table 1 esr1-blcap-1 1144725 n/a 1144728 unspecified role unspecified role bait bait region vp16 ad vp16 activation domain vp16 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1144732 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BLCAP interacts with ERalpha in the presence of 10nM Estradiol. Supplemental Table 1 esr1-dnm1l-1 1144725 n/a 1144733 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1144728 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region vp16 ad vp16 activation domain vp16 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplemental Table 1 DNM1L interaction with ERalpha is Estradiol independent. esr1-hax1-1 1144725 n/a 1144734 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1144728 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region vp16 ad vp16 activation domain vp16 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplemental Table 1 HAX1 interacts with ERalpha in the presence of 10nM Estradiol. esr1-ndrg2-1 1144725 n/a 1144728 unspecified role unspecified role bait bait region vp16 ad vp16 activation domain vp16 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1144736 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplemental Table 1 NDRG2 interacts with ERalpha in the presence of 10nM Estradiol. esr1-senp5-1 1144725 n/a 1144728 unspecified role unspecified role bait bait region vp16 ad vp16 activation domain vp16 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1144737 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplemental Table 1 SENP5 interaction with ERalpha is Estradiol independent. esr1-rac3-1 1144726 n/a 1144729 unspecified role unspecified role prey prey n/a 1144728 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1d esr1-rac3-3 1144726 n/a 1144729 unspecified role unspecified role prey prey P60763:p.Ser151Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n/a 1144728 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3d rac3-esr1 1144727 n/a 1144728 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection n/a 1144729 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1a, b The RAC3/ERalpha interaction was estradiol dependent and increased two-fold in the presence of GTP.