IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zeng-2010a-1 Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. xenla-oocyte Xenopus laevis oocyte Oocyte anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu Cancer Cell (1535-6108) 2010 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer zeng-2010a-2 Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. xenla-oocyte Xenopus laevis oocyte Oocyte anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu Cancer Cell (1535-6108) 2010 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer zeng-2010a-3 Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu Cancer Cell (1535-6108) 2010 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer zeng-2010a-4 Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. xenla-oocyte Xenopus laevis oocyte Oocyte pull down pull down western blot western blot Immuno blot Immuno blot Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu Cancer Cell (1535-6108) 2010 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer zeng-2010a-5 Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. xenla-oocyte Xenopus laevis oocyte Oocyte pull down pull down western blot western blot Immuno blot Immuno blot Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu Cancer Cell (1535-6108) 2010 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer zeng-2010a-6 Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. xenla-oocyte Xenopus laevis oocyte Oocyte crosslink cross-linking study crosslink ms participant Identification by mass spectrometry ms participant Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu Cancer Cell (1535-6108) 2010 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer zeng-2010a-7 Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. xenla-oocyte Xenopus laevis oocyte Oocyte anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu Cancer Cell (1535-6108) 2010 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer zeng-2010a-8 Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu Cancer Cell (1535-6108) 2010 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer zeng-2010a-9 Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. xenla-oocyte Xenopus laevis oocyte Oocyte anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu Cancer Cell (1535-6108) 2010 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer zeng-2010a-10 Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu Cancer Cell (1535-6108) 2010 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer cadh1_xenla Cadherin-1 cdh1 Epithelial cadherin Uvomorulin xTCAD-1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MGLKRPWLLGAVVLLTLIQVQGGLAEWTQCRMGFSKEKYSFLVPKNLETDKALGRVIFNSCEGPVRIQFASKDPNFEIHKDGTVYIKNPAKMKDNRKTFRVLAWETKGHVYSTNITLKREGHRHRQDLFSGKHSHHPKSETGLKRQKRDWVIPPIIVSENEKGPFPKRIVQIKSSYAKEVKVYYSITGQGADTPPEGVFAIGREDGWLNVTRPLDREAIDNYVLFSHAVSSNGANVEDPMEIIIKVQDQNDNDPVFTQSVFEGSVPEGSKPGTAVMTVSATDADDSVDMYNGVITYSILNQEPKEPTNKMFTIHSESGLISVLTTGLDREKNPVYTLTIQAADGEFGKDRTTTATALIVVMDTNDNPPVFDPTQYTAKVPENEVGYEVARLTVTDEDIEGTDAWNAVYKIIKGNEANYFSIQTDTGNIGLLKTVKGLDYELKKQYILSVIVTNKANFSVPLQTSTATVTVSVEDVNEAPIFLPPVKEVSVSEDLPSGQVVATYTAQDPDKEQNQKITYVIGNDPAGWVSVNKDNGIVTGNGNLDRESKFVLNNTYKVIILAADSGSPSATGTGTLVLNLLDVNDNGPFLEPQQESFCQKDPGFRVFTIIDRDLSPNTYPYKAELTGESNENWTAIVTGQSILELRPKKELEIGQYDVMITLLDSFGLSNVTKLHITICQCDGDKMQCEEKAAIAGGLGISAIVGILGGILALLLLLLLLLLFVRRKKVVKEPLLPPEDETRDNVFSYDEEGGGEEDQDFDLSQLHRGLDARPDVIRNDVAPVLAAPQYRPRPANPDEIGNFIDENLNAADNDPTAPPYDSLLVFDYEGSGSEAASLSSLNSPNSDLDQDYSALNDWGPRFTKLADMYGGDED q6gq04_xenla cdc27.S MGC80529 cdc27 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKAHSCTTPQCKYLLAKCCVDLGKLAEGEQILSGGVLNKQKSQEEIVTEFGDSACFTLSLLGHVYCKTDRLAKGAECYQKSLSLNPFLWSPFESLCEIGEKPDAEQTFKLTSLQSFSNCVPNTCTMTVNTHSVVQHRQPDTVLMETPQDTIELNRLNLESSNIKYPLNSDSSISYIDPGVISPDSLPLGTGNAILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQSYNSSCVLDVPSSGAPTKKSVARISQAGTKSVFSQSGNSRDVTPVLLVQTQGSGPQTSTTPQVLSPTIAAPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKMPNRKTKSKTSKGGGTQTNLNDSLEISKLDSSIISEGKISSVAPQIQALTIQKAAAEGLMSLLRDMGKGYVALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELAEYLQAERVFSEVRRIESYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPGYAYAFTLLGHEFVLTEELDKALACFRNSIRVNSRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSDKALDTLNKAISIDPKNPLCKFHRASILFANEKYKLALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEAVTQEEQISECYPYESVATDESQESSMTDADDTQLHAAESDEF 3h-tame Tritiated TAME :N -alpha-tosyl-L-arginine methyl ester small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) tosyl -L -arginine methyl ester cdc27_human Cell division cycle protein 27 homolog CDC27 D0S1430E D17S978E CDC27 homolog H-NUC ANAPC3 Anaphase-promoting complex subunit 3 protein protein human Homo sapiens Human MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF c_term_peptide C-FSKTRSTKESVSVLNLFTRIR protein protein chemical synthesis Chemical synthesis (Chemical synthesis) CFSKTRSTKESVSVLNLFTRIR An amino acid sequence which is not represented in UniProt q6dfd4_xenla cdc20.L LOC398044 cdc20 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAQFAFETDINSILKLDTPITNAPLARWQRKAKEGNCSSLNTSANTSTLSPMKASNRSHSSSKTPSKTPGKSGPKMQGTPSRAGGDRFIPNRSAMQMDVASFLLCKENEPVDTSPTKKEQQKAWAMNLNGFDMEEAKILRLGGRPQNAPEGYQNNLKVLYSQKTTPGSSKKTGRYIPSMPDRVLDAPDIRNDYYLNLIDWSSQNALAVALNDSVYLWNYATGDIILLLQMENSEEYISSVSWIKEGNYLAVGSSNAEVQLWDVQQQKRLRNMISHSSRVGALNWNNHILSSGSRTGHIHHHDVRVAQHHVSTLAGHTQEVCGLKWSPDGRYLASGANDNLVNVWPCVQGDSGEFSPVQTFTQHQAAVKAVAWCPWQSNVLATGGGTSDRHLRIWNVCSGTCLNSVDTHSQVCSIVWSTNYKELISGHGFAQNQLVLWKYPTMTRVTELKGHTARVLNLAMSPDGCTVASAAADETLRLWKCFEVDPVTKKEKEKARSSKSIIHQSIR apc1_xenla ANAPC1 Xenopus laevis protein protein xenla Xenopus laevis (African clawed frog) African clawed frog An amino acid sequence which is not represented in UniProt no gene model available in xenbase or any other database, let alone any protein. However, for X. tropicalis a gene model does exist. q6nu36_xenla Anaphase-promoting complex subunit 4 anapc4.L Cyclosome subunit 4 MGC81278 anapc4 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MPPFRQVGEKQLPHEIIFLAWSPKRDLIALVNKAGEVLLHRLANIQRVWSLPPNENTGKEVTCLAWRPDGKILAFGLADTKKVILCDVEKPESLHSFSLETPISCMQWMEVNVENSVLTSFYNAEDEANVLLPKLPALPKNYTATAKIFSEEKSDEILKLLGDARLNALVLGGDSGQIEIYAYGMYKIATISEVYGSCLRLCLSSDLKSLSVVTELTTNNTPEITYFQLDTSLLSDYLPEVTRMARKFTHISTLLQYLQLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSVQDEFMQLLLWGKASPELQALLMNQLTVKGLKKLGQSVESSYSTIQKLVISHLQSGAEALLYHLSELKGMALWRQKYEPLGLDAKAIEDAITAVGSFILKAHELLQVIDSGMKNFKAFFRWLYVAMLRMSEDHVLPELNKMTQKDITFVADFLTEHFNEAPDMYNQKGKYFNVERVGQYLKDEDDILMSPPNIEGNQWFSFLQSSTHLKESPLLFPYYPEKSLHFVKRQMEAIIDRCLTKPAQIIGASVQQKRCLPLYQVSASEEACPRLISLPYLWNDKSQNLHCVMFRMLESSSSKVFILRQPTDLSRSINEALLAVTIGNSLNSSAAEDTETSSYSCLDARFYDEDIITVVLRDNSEPEGKDRVLSQLSLSQLYSDEETEDEFTWDTSKRLEEQHSDIPTRTVFLENQGRLLENMKAHYVSVNGIRKVACVLSSNLRHVRVFEMDAEDDGEEEEEEILHSQDVTEEEEEFIQSVDEGQNNSAEAVDVTEESLDS q0ih16_xenla Anaphase-promoting complex subunit 5 anapc5.L anapc5 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKISVLVLLSEMSKNTKISLVEKRRLNKQILPLLQGPDMTLSKLIKIVEECCPNVSSSVHIRIKLMAEGELKDMEQFFDDLADSFTGTEPEVHKTSVVGLFLRHMILAYNKLSFSQVYKLYTSLQQYFQSEKSKATSKTDSDEADMDLTNNDEEEGKLEKEDLDFPIGEDDLACSGPLSQKQAEYFLSQQASLMKSDENKALTPVLLQKELNNLLKFNPDFAEAHYLSYLNSLRVQDVFSSTHSLLHYFDRLILTGAESKSNGDEGYGRSLRYAALNLAALHCRFGH c6ziw0_xenla protein protein xenla Xenopus laevis (African clawed frog) African clawed frog LAAPRPTTGESVVEADLKTALEVLHLYDLHSMVEEWFTEVLQMDLQRNIAPEFWNGINQHENAVEEEQCVVLLLDAFRLLMSRLDPYLRSLDILGRWIDTGLLVSSDSQMLRDKVYTMFKAILFFSTSKNFQDMIQQFYSRTFKIYMKQKKKADDSGSDCDSSMNENEHESDSDDRGGDDAECPGCQSNRDQCWCLCAMEQFQQLSNIFHRLNLLERVCSDAVTTILHKMIEERMEKKCRGEYERSFLGEFQEWIEKVIGWLSKVFLQDGTVPPTTPETSCTLKRWRCHVQRFFYRLYASMRIEELFNIIRDFPESKPAMK q6ddx5_xenla anapc7.L anapc7 anapc7-prov XELAEV_18007839mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPEMFSPSQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALTKTSKVRPATGNAAATPQNQCLPSEIEVKYKMADCYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKKAGQERSAVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTLNVIQSIPNLDWLSAWIKAYAFVHTGDNTRAINTICSLEKKSLLRDNVDLLGTLADLYFRVGDNKNAILKFEQAQMLDPYLIKGMDIYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYTKRHSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCCEGLIECYLASSSVREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALIQRPDYIKAVVKKAELLSREQKYDEGIALLRNTLANQSDCVLHRMLGDFLVVVNEFQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEPWFAMQ q6dfi7_xenla cdc16.L cdc16 cdc16-prov XELAEV_18012976mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MNLDRLRKRVRQYIEQQQYQSALFWADKVASLSHEEPQDIYWLAQCLYLTAQYHRASHALRSRKLDKVHEACRYLAARCHYAAKEYQQALDILDMEEPINKKLFEKSLKEDLKEPSGEWQMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKFDVYCFEAFDLLTAHHMLTAQEEKELLDSLPLSKKCSEDQELLRFLYENKLKKYNKPSETLIPESADGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHANCLPVHIGTLVELNKANELFYLSHKLVDLYPNNPVSWFAVGCYYLMVGHKNEHARRYLSKATALERSYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGDWKTAEKWFLDALEKIRVIGDEVTVDKWEPLLNNLGHVLRKLKKYDEALEYHRQALVLIPQNASTYSAIGYIHSLMGNFESAIDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSDAYIGTEIKDKLRCYDFDVHTMKTLKNIISPPWEEREFDFERQSLDESGIMALETSNLLPKSSDTRSPIEEALEIEMNESDMMLETSMSDHST q7t0n9_xenla cdc23.L cdc23 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAATIGMFSDLKEIKRQLLSVTWLCRERGLMNSVKWASELAFSLESVPLNELPSTPALTEEDAQDLDAYMLAKSYFDLKEYDRAAYFLRGCKSQKAYFMYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALREVRVELSKKHKARELDGFGLYLYGVVLRKLDLAKEALDVFVEATHVLPLHWGTWLELCNLITDKEMLKFLSLPDSWIKEFFLAHIYTELQLIEEALQKYQSLIDAGFSKSTYIISQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRGLKPELSYLAHNLCDIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLNESEQAAQCYIKYIQDIYSCGEIVEHQEVSTAFRYLAQYYFKCKLWDEASACAQKCFNFNDTREEGKALLRQILQLRNQSESPSAEPATAPFFLPQSLSANNTPTRRVSPLNLSSVTP cdc20_human Cell division cycle protein 20 homolog CDC20 p55CDC protein protein human Homo sapiens Human MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR cadh1_human Cadherin-1 Epithelial cadherin Uvomorulin CAM 120/80 CDH1 CDHE UVO protein protein human Homo sapiens Human MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDCTGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVGHHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDVNEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTGAISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD bub1b_human Mitotic checkpoint serine/threonine-protein kinase BUB1 beta MAD3/BUB1-related protein kinase Mitotic checkpoint kinase MAD3L SSK1 BUB1B BUBR1 MAD3L Protein SSK1 protein protein human Homo sapiens Human MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARVSRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKPTVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPYVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQRVQSHQQASEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEETMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAVLKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSEDQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQYRRQLLKSLPELSASAELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFYINLKLKERLNEDFDHFCSCYQYQDGCIVWHQYINCFTLQDLLQHSEYITHEITVLIIYNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPYDCNKNNQALKIVDFSYSVDLRVQLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVSVLGELAAEMNGVFDTTFQSHLNKALWKVGKLTSPGALLFQ md2l1_human Mitotic spindle assembly checkpoint protein MAD2A MAD2L1 MAD2 Mitotic arrest deficient 2-like protein 1 protein protein human Homo sapiens Human MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND cdc27-cdh1 997907 n/a 997917 unspecified role unspecified role prey prey n/a 997918 unspecified role unspecified role bait bait physical association physical association false false false Fig 1E. TAME - a small molecule inhibitor of the APC cdc27-3h-tame 997908 n/a 997919 unspecified role unspecified role prey prey n/a 997918 unspecified role unspecified role bait bait physical association physical association false false false Fig 2A, 2B, S2A. Binding of 3H-TAME correlated with the amount of immunoprecipitated Cdc27. Unlabeled TAME competes with 3H-TAME. cdc27-h3tame 997909 n/a 997920 unspecified role unspecified role bait bait n/a 997919 unspecified role unspecified role prey prey physical association physical association false false false Fig 2C. TAME binds to human APC. cdh1-cdc27 997910 n/a 997921 unspecified role unspecified role bait bait n/a 997918 unspecified role unspecified role prey prey physical association physical association false false false Fig 2E. Blasting the stated sequence of the Cdh1 C-terminal peptide shows it does not correspond to the C terminal sequence for Xenopus Laevis Cdh1, however, it does correspond to the C terminus of Chicken Cdh1 and the C terminus of Xenopus Fizzy-related protein (fzr1). The peptide lacking the C-terminal isoleucine and arginine residues binds only weakly to cdc27. TAME n_cdc20-cdc27 997911 n/a 997922 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_box deletion of aas 86-90 - DRFIP binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 997918 unspecified role unspecified role prey prey physical association physical association false false false Fig 2F. TAME does not inhibit the interaction between the C-box and the APC. cdh1-cdc27-1 997912 n/a 997923 unspecified role unspecified role prey prey n/a 997924 unspecified role unspecified role prey prey n/a 997925 unspecified role unspecified role prey prey n/a 997926 unspecified role unspecified role prey prey n/a 997927 unspecified role unspecified role prey prey n/a 997928 unspecified role unspecified role prey prey n/a 997929 unspecified role unspecified role prey prey n/a 997921 unspecified role unspecified role bait bait c terminus IR tail binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n terminus Mts-Atf-Biotin tag biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig 2G, S2B, S2C. Blasting the stated sequence of the Cdh1 C-terminal peptide shows it does not correspond to the C terminal sequence for Xenopus Laevis Cdh1, however, it does correspond to the C terminus of Chicken Cdh1 and the C terminus of Xenopus Fizzy-related protein (fzr1). TAME Four proteins known to exist in an APC subcomplex, namely, Cdc27, Cdc16, Cdc23, and Apc7, were crosslinked in an IR-dependent manner that could be competed by excess unlabeled IR peptide. n_cdc20-cdc27-1 997913 n/a 997930 unspecified role unspecified role prey prey ir_tail C terminal IR tail binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 997918 unspecified role unspecified role bait bait physical association physical association false false false Fig 3. TAME, C box containing N-terminal fragment of Cdc20 (aa's 1-159). In the presence of the C-box-containing N-terminal fragment of Cdc20, the addition of TAME or deletion of the IR-tail was sufficient to completely suppress Cdc20 association with cdc27. cdc27-cadh1 997914 n/a 997920 unspecified role unspecified role bait bait n/a 997931 unspecified role unspecified role prey prey physical association physical association false false false Fig 4C. pro-TAME; a cell permeable derivative of TAME. cdh1-cdc27-2 997915 n/a 997923 unspecified role unspecified role prey prey n/a 997924 unspecified role unspecified role prey prey n/a 997925 unspecified role unspecified role prey prey n/a 997926 unspecified role unspecified role prey prey n/a 997928 unspecified role unspecified role prey prey n/a 997927 unspecified role unspecified role prey prey n/a 997929 unspecified role unspecified role prey prey n/a 997918 unspecified role unspecified role bait bait physical association physical association false false false Fig S1E. The participant EBI-2944289(C6ZIW0) was duplicated. It is posssible that originally this interaction did contain more participants pointing to different Trembl proteins which have been merged to a single swissprot protein later. cdc27-cdc20 997916 n/a 997932 unspecified role unspecified role prey prey n/a 997933 unspecified role unspecified role prey prey n/a 997930 unspecified role unspecified role prey prey n/a 997920 unspecified role unspecified role bait bait physical association physical association false false false Fig S5D, S5E, S6B. proTAME induced significant dissociation of Cdc20/cdc27, but only if SAC proteins were depleted by RNAi (Fig S5D). Hesperadin treatment led to dissociation of Mad2 and BubR1 from the APC in proTAME-arrested cells (Fig S5E). Hesperadin reduces the amount of Mad2/BubR1 bound to the cdc27 in cells arrested in mitosis with MG132 (Fig S6B). Hesperadin - a small molecule inhibitor of chromosome alignment and segregation.