I2D I2D jang-2011-4 Phosphorylation by polo-like kinase 1 induces the tumor-suppressing activity of FADD. in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography Jang MS., Lee SJ., Kim CJ., Lee CW., Kim E. Apoptosis - Interactions involving proteins with a function related to apoptosis Author confirms that all Plk1 constructs are of human origin eunhee@cnu.ac.kr Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer jang-2011-6 Phosphorylation by polo-like kinase 1 induces the tumor-suppressing activity of FADD. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Jang MS., Lee SJ., Kim CJ., Lee CW., Kim E. Apoptosis - Interactions involving proteins with a function related to apoptosis eunhee@cnu.ac.kr Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer jang-2011-1 Phosphorylation by polo-like kinase 1 induces the tumor-suppressing activity of FADD. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jang MS., Lee SJ., Kim CJ., Lee CW., Kim E. Apoptosis - Interactions involving proteins with a function related to apoptosis eunhee@cnu.ac.kr Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer jang-2011-2 Phosphorylation by polo-like kinase 1 induces the tumor-suppressing activity of FADD. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Jang MS., Lee SJ., Kim CJ., Lee CW., Kim E. Apoptosis - Interactions involving proteins with a function related to apoptosis HeLa lysates were fractionated by FPLC on Superose 6 column eunhee@cnu.ac.kr Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer jang-2011-3 Phosphorylation by polo-like kinase 1 induces the tumor-suppressing activity of FADD. in vitro In vitro pull down pull down autoradiography autoradiography Jang MS., Lee SJ., Kim CJ., Lee CW., Kim E. Apoptosis - Interactions involving proteins with a function related to apoptosis Author confirms that all Plk1 constructs are of human origin eunhee@cnu.ac.kr Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer jang-2011-5 Phosphorylation by polo-like kinase 1 induces the tumor-suppressing activity of FADD. in vitro In vitro immunodepletion immunodepleted coimmunoprecipitation immunodepleted coip immunodepletion western blot western blot Immuno blot Immuno blot Jang MS., Lee SJ., Kim CJ., Lee CW., Kim E. Apoptosis - Interactions involving proteins with a function related to apoptosis eunhee@cnu.ac.kr Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer plk1_human Serine/threonine-protein kinase PLK1 Polo-like kinase 1 Serine/threonine-protein kinase 13 PLK1 PLK protein protein human Homo sapiens Human MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEEPVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS fadd-plk1-9 1132867 n/a 1132873 enzyme enzyme unspecified role unspecified role region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P53350:p.Thr210Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 n/a 1132874 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false 2b Interaction detected after treatment with 25nM taxol for 12 hr. Flag-Plk1 was immunoprecipitated from HeLa cells using anti-Flag antibody. The immunoprecipitates were then incubated with GST-FADD in the presence of [32P]ATP. Proteins were then visualized using autoradiography. fadd-plk1-7 1132867 n/a 1132873 enzyme enzyme unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P53350:p.Thr210Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1132874 enzyme target enzyme target substrate substrate unspecified role unspecified role c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q13158:p.Ser194Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false 2d GST-C-FADD or GST-C-FADD S194A was incubated with GST-Plk1 in the presence of [32P]ATP fadd-plk1-8 1132867 n/a 1132873 enzyme enzyme unspecified role unspecified role n/a 1132874 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylation phosphorylation reaction phosphorylation false false false S3 fadd-plk1-4 1132868 n/a 1132873 unspecified role unspecified role neutral component neutral component n/a 1132874 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false S1 Taxol treatment of cells resulted in colocalization fadd-plk1-5 1132868 n/a 1132873 unspecified role unspecified role neutral component neutral component n/a 1132874 unspecified role unspecified role neutral component neutral component phospho group opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false S1 Taxol treatment of cells resulted in colocalization fadd-plk1 1132869 n/a 1132874 unspecified role unspecified role bait bait n/a 1132873 unspecified role unspecified role prey prey physical association physical association false false false The interaction of Plk1 and FADD increases with increased concentration of Taxol (0.025-30uM) and duration of stimulation by 25uM Taxol (0-24hr). 1a,b fadd-plk1-2 1132870 n/a 1132873 unspecified role unspecified role neutral component neutral component n/a 1132874 unspecified role unspecified role neutral component neutral component physical association physical association false false false 1c Endogenous Plk1 and FADD cofiltrate as a low-molecular-weight complex (43kDa). After stimulation with 25nM Taxol, Plk1 and FADD cofiltrate as a high-molecular-weight complex (>200kDa) plk1-fadd 1132871 n/a 1132873 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1132874 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false 1d fadd-plk1-3 1132872 n/a 1132874 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132873 unspecified role unspecified role prey prey physical association physical association false false false 2c