I2D I2D zhu-2011a-2 Vimentin is a novel AKT1 target mediating motility and invasion. human-sklms1 Human vulva leiomyosarcoma sklms1 Human vulval leiomyosarcoma ATCC accession number: HTB-88 This cell line has a codon 245 p53 point mutation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer zhu-2011a-3 Vimentin is a novel AKT1 target mediating motility and invasion. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis Amino acid numbering for regions of Vimentin/AKT1 taken from primers listed in the materials and methods. dlev@mdanderson.org Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer zhu-2011a-6 Vimentin is a novel AKT1 target mediating motility and invasion. human-leiomyosarcoma Human leiomyosarcoma leiomyosarcoma Leiomyosarcoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer zhu-2011a-7 Vimentin is a novel AKT1 target mediating motility and invasion. human-mfhistiocytoma Human malignant fibrous histiocytoma mfhistiocytoma Malignant fibrous histiocytoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer zhu-2011a-16 Vimentin is a novel AKT1 target mediating motility and invasion. human-uncl Human unclassified pleomorphic sarcoma primary cell line uncl Human unclassified pleomorphic sarcoma primary cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer zhu-2011a-5 Vimentin is a novel AKT1 target mediating motility and invasion. in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer zhu-2011a-1 Vimentin is a novel AKT1 target mediating motility and invasion. human-ht1080 Homo sapiens HT1080 fribrosarcoma cell line ht1080 confirmed as human with IEF of AST, LDH, NP established from the biopsy from a fibrosarcoma of a 35-year-old Caucasian man in 1972 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer zhu-2011a-13 Vimentin is a novel AKT1 target mediating motility and invasion. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer zhu-2011a-15 Vimentin is a novel AKT1 target mediating motility and invasion. human-mfh_m Human high grade malignant fibrosarcoma primary cell line mfh_m Human high grade malignant fibrosarcoma primary cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer zhu-2011a-17 Vimentin is a novel AKT1 target mediating motility and invasion. human-leio_177 Human high grade leiomyosarcoma primary cell line leio_177 Human high grade leiomyosarcoma primary cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer zhu-2011a-4 Vimentin is a novel AKT1 target mediating motility and invasion. human-sklms1 Human vulva leiomyosarcoma sklms1 Human vulval leiomyosarcoma ATCC accession number: HTB-88 This cell line has a codon 245 p53 point mutation. anti bait coip anti bait coimmunoprecipitation anti bait coip sequence tag sequence tag identification sequence tag Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis The molecule "alpha-Actin, identifier Gi73947744" has not been entered, as the nearest match is (human) O43707 (Alpha-actinin-4) , which shares 96% identity with GI:73947744, which is a canine protein. Author confirms that SKLMS-1 cells were used. dlev@mdanderson.org Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer zhu-2011a-8 Vimentin is a novel AKT1 target mediating motility and invasion. in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer zhu-2011a-9 Vimentin is a novel AKT1 target mediating motility and invasion. human-sklms1 Human vulva leiomyosarcoma sklms1 Human vulval leiomyosarcoma ATCC accession number: HTB-88 This cell line has a codon 245 p53 point mutation. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer zhu-2011a-10 Vimentin is a novel AKT1 target mediating motility and invasion. human-sklms1 Human vulva leiomyosarcoma sklms1 Human vulval leiomyosarcoma ATCC accession number: HTB-88 This cell line has a codon 245 p53 point mutation. fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer zhu-2011a-11 Vimentin is a novel AKT1 target mediating motility and invasion. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer zhu-2011a-12 Vimentin is a novel AKT1 target mediating motility and invasion. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer zhu-2011a-14 Vimentin is a novel AKT1 target mediating motility and invasion. in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer zhu-2011a-18 Vimentin is a novel AKT1 target mediating motility and invasion. human-sklms1 Human vulva leiomyosarcoma sklms1 Human vulval leiomyosarcoma ATCC accession number: HTB-88 This cell line has a codon 245 p53 point mutation. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer akt1_human RAC-alpha serine/threonine-protein kinase AKT1 PKB RAC RAC-PK-alpha Protein kinase B Proto-oncogene c-Akt Protein kinase B alpha protein protein human Homo sapiens Human MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA vime_human Vimentin VIM protein protein human Homo sapiens Human MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE ddx5_human Probable ATP-dependent RNA helicase DDX5 HLR1 DDX5 HELR G17P1 DEAD box protein 5 RNA helicase p68 protein protein human Homo sapiens Human MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQ grp75_human Stress-70 protein, mitochondrial HSPA9 GRP75 HSPA9B 75 kDa glucose-regulated protein Heat shock 70 kDa protein 9 Peptide-binding protein 74 Mortalin mt-HSP70 protein protein human Homo sapiens Human MISASRAAAARLVGAAASRGPTAARHQDSWNGLSHEAFRLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSEDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLTKDNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ mdm2_human E3 ubiquitin-protein ligase Mdm2 MDM2 p53-binding protein Mdm2 Oncoprotein Mdm2 Double minute 2 protein RING-type E3 ubiquitin transferase Mdm2 protein protein human Homo sapiens Human MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQDKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP gsk3b_human Glycogen synthase kinase-3 beta GSK3B Serine/threonine-protein kinase GSK3B protein protein human Homo sapiens Human MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST akt2_human RAC-beta serine/threonine-protein kinase AKT2 RAC-PK-beta Protein kinase Akt-2 Protein kinase B beta protein protein human Homo sapiens Human MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIRE crosstide Crosstide Ser/Thr protein kinase substrate peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) GRPRTSSFAEG tpm2_human Tropomyosin beta chain TPM2 TMSB Tropomyosin-2 Beta-tropomyosin protein protein human Homo sapiens Human MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVKEAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESKCGDLEEELKIVTNNLKSLEAQADKYSTKEDKYEEEIKLLEEKLKEAETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF tpm4_human Tropomyosin alpha-4 chain TPM4 Tropomyosin-4 TM30p1 protein protein human Homo sapiens Human MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI tbb4b_human Tubulin beta-4B chain TUBB4B TUBB2C Tubulin beta-2 chain Tubulin beta-2C chain protein protein human Homo sapiens Human MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEEAEEEVA trhde_human Thyrotropin-releasing hormone-degrading ectoenzyme Pyroglutamyl-peptidase II TRH-specific aminopeptidase Thyroliberinase UNQ2507/PRO5995 TRHDE protein protein human Homo sapiens Human MGEDDAALRAGSRGLSDPWADSVGVRPRTTERHIAVHKRLVLAFAVSLVALLAVTMLAVLLSLRFDECGASATPGADGGPSGFPERGGNGSLPGSARRNHHAGGDSWQPEAGGVASPGTTSAQPPSEEEREPWEPWTQLRLSGHLKPLHYNLMLTAFMENFTFSGEVNVEIACRNATRYVVLHASRVAVEKVQLAEDRAFGAVPVAGFFLYPQTQVLVVVLNRTLDAQRNYNLKIIYNALIENELLGFFRSSYVLHGERRFLGVTQFSPTHARKAFPCFDEPIYKATFKISIKHQATYLSLSNMPVETSVFEEDGWVTDHFSQTPLMSTYYLAWAICNFTYRETTTKSGVVVRLYARPDAIRRGSGDYALHITKRLIEFYEDYFKVPYSLPKLDLLAVPKHPYAAMENWGLSIFVEQRILLDPSVSSISYLLDVTMVIVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEFVGTDYLYPGWNMEKQRFLTDVLHEVMLLDGLASSHPVSQEVLQATDIDRVFDWIAYKKGAALIRMLANFMGHSVFQRGLQDYLTIHKYGNAARNDLWNTLSEALKRNGKYVNIQEVMDQWTLQMGYPVITILGNTTAENRIIITQQHFIYDISAKTKALKLQNNSYLWQIPLTIVVGNRSHVSSEAIIWVSNKSEHHRITYLDKGSWLLGNINQTGYFRVNYDLRNWRLLIDQLIRNHEVLSVSNRAGLIDDAFSLARAGYLPQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDRMENYNIFNEYILKQVATTYIKLGWPKNNFNGSLVQASYQHEELRREVIMLACSFGNKHCHQQASTLISDWISSNRNRIPLNVRDIVYCTGVSLLDEDVWEFIWMKFHSTTAVSEKKILLEALTCSDDRNLLNRLLNLSLNSEVVLDQDAIDVIIHVARNPHGRDLAWKFFRDKWKILNTRYGEALFMNSKLISGVTEFLNTEGELKELKNFMKNYDGVAAASFSRAVETVEANVRWKMLYQDELFQWLGKALRH vim-akt1-1 1132603 n/a 1132621 unspecified role unspecified role prey prey n/a 1132622 unspecified role unspecified role bait bait physical association physical association false false false 3c akt1-vim-1 1132603 n/a 1132622 unspecified role unspecified role prey prey n/a 1132621 unspecified role unspecified role bait bait physical association physical association false false false 3c akt1-ddx5-2 1132603 n/a 1132623 unspecified role unspecified role prey prey n/a 1132622 unspecified role unspecified role prey prey n/a 1132624 unspecified role unspecified role prey prey n/a 1132621 unspecified role unspecified role bait bait association association false false false 3a Author confirms that SKLMS-1 cells were used for this experiment. akt1-gsk3b 1132603 n/a 1132625 unspecified role unspecified role prey prey n/a 1132626 unspecified role unspecified role prey prey n/a 1132621 unspecified role unspecified role bait bait association association false false false 3a Author confirms that SKLMS-1 cells were used for this experiment. akt1-vim-3 1132604 n/a 1132622 unspecified role unspecified role prey prey human-sklms1 Human vulva leiomyosarcoma sklms1 Human vulval leiomyosarcoma ATCC accession number: HTB-88 This cell line has a codon 245 p53 point mutation. n/a 1132621 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 4b vim-akt1-2 1132604 n/a 1132622 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1132621 unspecified role unspecified role prey prey human-sklms1 Human vulva leiomyosarcoma sklms1 Human vulval leiomyosarcoma ATCC accession number: HTB-88 This cell line has a codon 245 p53 point mutation. physical association physical association false false false 4c akt1-vim-4 1132604 n/a 1132622 unspecified role unspecified role prey prey n/a 1132621 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 4d vim-akt1-3 1132604 n/a 1132621 unspecified role unspecified role prey prey n/a 1132622 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 4d vim-akt1-4 1132605 n/a 1132622 unspecified role unspecified role bait bait n/a 1132621 unspecified role unspecified role prey prey physical association physical association false false false 3c akt1-vim-5 1132605 n/a 1132622 unspecified role unspecified role prey prey n/a 1132621 unspecified role unspecified role bait bait physical association physical association false false false 3c vim-akt2-1 1132605 n/a 1132622 unspecified role unspecified role bait bait n/a 1132627 unspecified role unspecified role prey prey physical association physical association false false false 3c akt2-vim-1 1132605 n/a 1132627 unspecified role unspecified role bait bait n/a 1132622 unspecified role unspecified role prey prey physical association physical association false false false 3c akt1-vim-6 1132606 n/a 1132622 unspecified role unspecified role prey prey n/a 1132621 unspecified role unspecified role bait bait physical association physical association false false false 3c vim-akt1-5 1132606 n/a 1132621 unspecified role unspecified role prey prey n/a 1132622 unspecified role unspecified role bait bait physical association physical association false false false 3c akt2-vim 1132606 n/a 1132627 unspecified role unspecified role bait bait n/a 1132622 unspecified role unspecified role prey prey physical association physical association false false false 3c vim-akt2 1132606 n/a 1132622 unspecified role unspecified role bait bait n/a 1132627 unspecified role unspecified role prey prey physical association physical association false false false 3c akt1-vim-13 1132607 n/a 1132621 unspecified role unspecified role bait bait n/a 1132622 unspecified role unspecified role prey prey physical association physical association false false false 3c vim-akt1-11 1132607 n/a 1132621 unspecified role unspecified role prey prey n/a 1132622 unspecified role unspecified role bait bait physical association physical association false false false 3c akt2-vim-2 1132607 n/a 1132622 unspecified role unspecified role prey prey n/a 1132627 unspecified role unspecified role bait bait physical association physical association false false false 3c vim-akt2-2 1132607 n/a 1132627 unspecified role unspecified role prey prey n/a 1132622 unspecified role unspecified role bait bait physical association physical association false false false 3c akt1-crosstide 1132608 n/a 1132621 unspecified role unspecified role bait bait human-sklms1 Human vulva leiomyosarcoma sklms1 Human vulval leiomyosarcoma ATCC accession number: HTB-88 This cell line has a codon 245 p53 point mutation. n/a 1132628 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylation phosphorylation reaction phosphorylation false false false 2c Crosstide is phosphorylated by AKT1. EGF akt1-crosstide-1 1132608 n/a 1132621 unspecified role unspecified role bait bait human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma n/a 1132628 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylation phosphorylation reaction phosphorylation false false false 2c Crosstide is phosphorylated by AKT1. EGF akt2-crosstide 1132608 n/a 1132628 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1132627 unspecified role unspecified role bait bait human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma phosphorylation phosphorylation reaction phosphorylation false false false 2c Crosstide is phosphorylated by AKT2. EGF akt1-vim 1132609 n/a 1132621 unspecified role unspecified role bait bait n/a 1132622 unspecified role unspecified role prey prey physical association physical association false false false 3c vim-akt1 1132609 n/a 1132621 unspecified role unspecified role prey prey n/a 1132622 unspecified role unspecified role bait bait physical association physical association false false false 3c akt1-vim-11 1132610 n/a 1132622 unspecified role unspecified role prey prey n/a 1132621 unspecified role unspecified role bait bait physical association physical association false false false S3e vim-akt1-8 1132610 n/a 1132621 unspecified role unspecified role prey prey n/a 1132622 unspecified role unspecified role bait bait physical association physical association false false false S3e akt1-vim-12 1132611 n/a 1132621 unspecified role unspecified role bait bait n/a 1132622 unspecified role unspecified role prey prey physical association physical association false false false 3c vim-akt1-10 1132611 n/a 1132621 unspecified role unspecified role prey prey n/a 1132622 unspecified role unspecified role bait bait physical association physical association false false false 3c vim-akt1-12 1132612 n/a 1132621 unspecified role unspecified role prey prey n/a 1132622 unspecified role unspecified role bait bait physical association physical association false false false 3c akt1-vim-14 1132612 n/a 1132622 unspecified role unspecified role prey prey n/a 1132621 unspecified role unspecified role bait bait physical association physical association false false false 3c akt1-ddx5-3 1132613 n/a 1132629 unspecified role unspecified role prey prey n/a 1132630 unspecified role unspecified role prey prey n/a 1132631 unspecified role unspecified role prey prey n/a 1132632 unspecified role unspecified role prey prey n/a 1132633 unspecified role unspecified role prey prey n/a 1132621 unspecified role unspecified role bait bait n/a 1132624 unspecified role unspecified role prey prey n/a 1132623 unspecified role unspecified role prey prey n/a 1132622 unspecified role unspecified role prey prey association association false false false 3a, Table S1 vim-akt1-6 1132614 n/a 1132621 unspecified role unspecified role prey prey P31749:p.[Lys179Ala;Thr308Ala;Ser473Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P31749:p.[Thr308Asp;Ser473Asp] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 1132622 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P08670:p.Ser39Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P08670:p.Ser325Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false 5c, e Phosphorylation of vimentin. akt1-vim-7 1132615 n/a 1132621 unspecified role unspecified role neutral component neutral component n/a 1132622 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false S3a akt1-vim-8 1132616 n/a 1132621 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132622 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false S3b akt1-vim-9 1132617 n/a 1132621 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132622 unspecified role unspecified role prey prey physical association physical association false false false S3d vim-akt1-7 1132618 n/a 1132622 unspecified role unspecified role bait bait n/a 1132621 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S3d akt1-vim-15 1132619 n/a 1132621 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132622 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) colocalization colocalization false false false S3f akt1-vim-16 1132620 n/a 1132621 unspecified role unspecified role neutral component neutral component venus_n_terminal_region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132622 unspecified role unspecified role neutral component neutral component venus_c_terminal_region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S3c