IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ koh-2010-2 Double antiangiogenic protein, DAAP, targeting VEGF-A and angiopoietins in tumor angiogenesis, metastasis, and vascular leakage. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Koh YJ., Kim HZ., Hwang SI., Lee JE., Oh N., Jung K., Kim M., Kim KE., Kim H., Lim NK., Jeon CJ., Lee GM., Jeon BH., Nam DH., Sung HK., Nagy A., Yoo OJ., Koh GY. Cancer - Interactions investigated in the context of cancer Immunoprecipitates were captured by Protein-A and western blotted with anti-FLAG antibody. Species of molecules used confirmed by the authors. gykoh@kaist.ac.kr Cancer Cell (1535-6108) 2010 Only protein-protein interactions imex curation koh-2010-1 Double antiangiogenic protein, DAAP, targeting VEGF-A and angiopoietins in tumor angiogenesis, metastasis, and vascular leakage. in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Koh YJ., Kim HZ., Hwang SI., Lee JE., Oh N., Jung K., Kim M., Kim KE., Kim H., Lim NK., Jeon CJ., Lee GM., Jeon BH., Nam DH., Sung HK., Nagy A., Yoo OJ., Koh GY. Cancer - Interactions investigated in the context of cancer Species of molecules used confirmed by the authors. gykoh@kaist.ac.kr Cancer Cell (1535-6108) 2010 Only protein-protein interactions imex curation koh-2010-3 Double antiangiogenic protein, DAAP, targeting VEGF-A and angiopoietins in tumor angiogenesis, metastasis, and vascular leakage. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Koh YJ., Kim HZ., Hwang SI., Lee JE., Oh N., Jung K., Kim M., Kim KE., Kim H., Lim NK., Jeon CJ., Lee GM., Jeon BH., Nam DH., Sung HK., Nagy A., Yoo OJ., Koh GY. Cancer - Interactions investigated in the context of cancer Species of molecules used confirmed by the authors. gykoh@kaist.ac.kr Cancer Cell (1535-6108) 2010 Only protein-protein interactions imex curation p15692-4 Vascular endothelial growth factor A VEGF VEGFA VEGF Vascular permeability factor protein protein human Homo sapiens Human MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR daap-5 Human f usion protein: Ig2 domain from VEGFR1, and Tie2 aas 1-348. protein protein human Homo sapiens Human An amino acid sequence which is not represented in UniProt q00731-2 Vascular endothelial growth factor A VEGF164 Vegfa Vegf Vascular permeability factor protein protein mouse Mus musculus Mouse MNFLLSWVHWTLALLLYLHHAKWSQAAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR p15692-2 Vascular endothelial growth factor A VEGFA VEGF Vascular permeability factor protein protein human Homo sapiens Human MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR p15692-9 Vascular endothelial growth factor A VEGFA VEGF Vascular permeability factor protein protein human Homo sapiens Human MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR No experimental confirmation available. pigf_mouse Phosphatidylinositol-glycan biosynthesis class F protein Pigf protein protein mouse Mus musculus Mouse MKDTDIKRLLYTNLLCVFSIFLSIFIPSFFVDNFSVLEAHLTWLCICSASVTTVNLLSYLVVKPNVSSKRSSLSHKVTRALKCCVCFLMSCFLLHIIFVLYGAPLIELVLETFLFAVVLSTFTTVPCLCLLGPNLKAWLRVFSRNGVTSIWENSLQITTISSFTGAWLGAFPIPLDWERPWQVWPISCTLGATFGYVAGLVISPLWIYWNRKQLTYKNN angp2_human Angiopoietin-2 ANGPT2 protein protein human Homo sapiens Human MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF angp2_mouse Angiopoietin-2 Angpt2 Agpt2 protein protein mouse Mus musculus Mouse MWQIIFLTFGWDLVLASAYSNFRKSVDSTGRRQYQVQNGPCSYTFLLPETDSCRSSSSPYMSNAVQRDAPLDYDDSVQRLQVLENILENNTQWLMKLENYIQDNMKKEMVEIQQNVVQNQTAVMIEIGTSLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEGKHSEQLQSMKEQKDELQVLVSKQSSVIDELEKKLVTATVNNSLLQKQQHDLMETVNSLLTMMSSPNSKSSVAIRKEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF angp1_human Angiopoietin-1 ANGPT1 KIAA0003 protein protein human Homo sapiens Human MTVFLSFAFLAAILTHIGCSNQRRSPENSGRRYNRIQHGQCAYTFILPEHDGNCRESTTDQYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAVQNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF angp4_mouse Angiopoietin-4 Angpt4 Agpt4 Ang3 Angiopoietin-3 protein protein mouse Mus musculus Mouse MLCQPAMLLDGLLLLATMAAAQHRGPEAGGHRQIHQVRRGQCSYTFVVPEPDICQLAPTAAPEALGGSNSLQRDLPASRLHLTDWRAQRAQRAQRVSQLEKILENNTQWLLKLEQSIKVNLRSHLVQAQQDTIQNQTTTMLALGANLMNQTKAQTHKLTAVEAQVLNQTLHMKTQMLENSLSTNKLERQMLMQSRELQRLQGRNRALETRLQALEAQHQAQLNSLQEKREQLHSLLGHQTGTLANLKHNLHALSSNSSSLQQQQQQLTEFVQRLVRIVAQDQHPVSLKTPKPVFQDCAEIKRSGVNTSGVYTIYETNMTKPLKVFCDMETDGGGWTLIQHREDGSVNFQRTWEEYKEGFGNVAREHWLGNEAVHRLTSRTAYLLRVELHDWEGRQTSIQYENFQLGSERQRYSLSVNDSSSSAGRKNSLAPQGTKFSTKDMDNDNCMCKCAQMLSGGWWFDACGLSNLNGIYYSVHQHLHKINGIRWHYFRGPSYSLHGTRMMLRPMGA angp4_human Angiopoietin-4 ANGPT4 ANG3 ANG4 Angiopoietin-3 protein protein human Homo sapiens Human MLSQLAMLQGSLLLVVATMSVAQQTRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTILRSKLEQVQQQMAQNQTAPMLELGTSLLNQTTAQIRKLTDMEAQLLNQTSRMDAQMPETFLSTNKLENQLLLQRQKLQQLQGQNSALEKRLQALETKQQEELASILSKKAKLLNTLSRQSAALTNIERGLRGVRHNSSLLQDQQHSLRQLLVLLRHLVQERANASAPAFIMAGEQVFQDCAEIQRSGASASGVYTIQVSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYKQGFGDPAGEHWLGNEVVHQLTRRAAYSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVGYSGSAGRQSSLVLQNTSFSTLDSDNDHCLCKCAQVMSGGWWFDACGLSNLNGVYYHAPDNKYKMDGIRWHYFKGPSYSLRASRMMIRPLDI vegf_trap Human fusion protein: VEGF-TRAP: (Ig2) of VEGFR1 and (Ig3) of VEGFR2 protein protein human Homo sapiens Human An amino acid sequence which is not represented in UniProt tie2_human Angiopoietin-1 receptor TEK TIE2 Tyrosine-protein kinase receptor TIE-2 Tyrosine-protein kinase receptor TEK Tunica interna endothelial cell kinase p140 TEK Endothelial tyrosine kinase Tyrosine kinase with Ig and EGF homology domains-2 VMCM VMCM1 protein protein human Homo sapiens Human MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIQRMTPKIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSGVWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKKLLYKPVNHYEAWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTASIGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSVLLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWTILDGYSISSITIRYKVQGKNEDQHVDVKIKNATITQYQLKGLEPETAYQVDIFAENNIGSSNPAFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA daap-4 Human fusion protein: Ig2 and Ig3 domains from VEGFR1, and Tie2 aas 1-348. protein protein human Homo sapiens Human An amino acid sequence which is not represented in UniProt daap-7 Human f usion protein: Ig2 domain from VEGFR1 and Tie2 aas 122-348. protein protein human Homo sapiens Human An amino acid sequence which is not represented in UniProt daap5-h_vegfa165 977893 n/a 977896 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977897 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false direct interaction direct interaction false false false Fig 1C. daap5-m_vegfa164 977893 n/a 977897 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977898 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction false false false Fig 1C. daap5-h_vegfa189 977893 n/a 977899 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) n/a 977897 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig 1C. daap5-h_vegfa121 977893 n/a 977900 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) n/a 977897 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig 1C. daap5-mpigf 977893 n/a 977901 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) n/a 977897 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig 1C. daap5-hang2 977893 n/a 977897 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977902 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig 1C. daap5-h_mang2 977893 n/a 977897 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977903 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction false false false Fig 1C. daap5-h_ang1 977893 n/a 977897 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977904 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction false false false Fig 1C. daap5-m_ang3 977893 n/a 977897 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977905 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction false false false Fig 1C. daap5-hang4 977893 n/a 977897 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977906 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction false false false Fig 1C. vt-h_vegfa165-1 977893 n/a 977907 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977896 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig 1C. vt-m_vegfa164-1 977893 n/a 977898 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) n/a 977907 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig 1C. vt-h_vegfa189-1 977893 n/a 977899 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) n/a 977907 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig 1C. vt-h_vegfa121-1 977893 n/a 977900 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) n/a 977907 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig 1C. vt-mpigf-1 977893 n/a 977901 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) n/a 977907 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig 1C. tie2-hang2 977893 n/a 977908 unspecified role unspecified role bait bait n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977902 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig 1C. tie2-h_mang2-1 977893 n/a 977903 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) n/a 977908 unspecified role unspecified role bait bait n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig 1C. tie2-h_ang1-1 977893 n/a 977904 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) n/a 977908 unspecified role unspecified role bait bait n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig 1C. tie2-m_ang3-1 977893 n/a 977908 unspecified role unspecified role bait bait n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977905 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction false false false Fig 1C. tie2-hang4-1 977893 n/a 977908 unspecified role unspecified role bait bait n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977906 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction false false false Fig 1C. vegfa-daap4 977894 n/a 977896 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 977909 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig 1B. DAAP-4 and DAAP-5 were capable of binding both VEGF-A and Ang-2, wheras DAAP-7 only bound to VEGFA. VEGFA is not explicitly stated to be tagged nor CHO cell derived. ang2-daap4 977894 n/a 977909 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977902 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig 1B, S1A. DAAP-4 and DAAP-5 were capable of binding both VEGF-A and Ang-2, wheras DAAP-7 only bound to VEGFA. The Tie2 (Ig2 domain+Fc) also weakly binds to Ang-2. Ang-2 is not explicitly stated to be tagged nor CHO cell derived. vegfa-daap5 977894 n/a 977896 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977897 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig 1B, 1D. DAAP-4 and DAAP-5 were capable of binding both VEGF-A and Ang-2, wheras DAAP-7 only bound to VEGFA. Affinity constant for VEGFA165/DAAP-5 binding is ~4.6pM. VEGFA is not explicitly stated to be tagged nor CHO cell derived. vegfa-daap7 977894 n/a 977896 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977910 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig 1B. DAAP-4 and DAAP-5 were capable of binding both VEGF-A and Ang-2, wheras DAAP-7 only bound to VEGFA. VEGFA is not explicitly stated to be tagged nor CHO cell derived. ang2-daap5 977894 n/a 977902 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977897 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig 1B, S1A, 1E. DAAP-4 and DAAP-5 were capable of binding both VEGF-A and Ang-2, wheras DAAP-7 only bound to VEGFA. The Tie2 (Ig2 domain+Fc) also weakly binds to Ang-2. Affinity constant for Ang2/DAAP-5 binding is ~10pM. Ang-2 is not explicitly stated to be tagged nor CHO cell derived. ang2-tie2_122-213 977894 n/a 977902 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977908 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig 1B, S1A. DAAP-4 and DAAP-5 were capable of binding both VEGF-A and Ang-2, wheras DAAP-7 only bound to VEGFA. The Tie2 (Ig2 domain+Fc) also weakly binds to Ang-2. Ang-2 is not explicitly stated to be tagged nor CHO cell derived. vegfa165-vt 977894 n/a 977896 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977907 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig 1D, S1I. Affinity constant for VEGFA165/VEGF-Trap binding is ~1.7pM. The VEGFA is not explicitly stated to be flag-tagged nor CHO cell derived. hang2-tie2 977894 n/a 977908 unspecified role unspecified role prey prey n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977902 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig 1E, S1J. Affinity constant for Tie2-Fc/ang2 binding is ~50pM. Ang-2 is not explicitly stated to be tagged nor CHO cell derived. daap5-hang2-vegfa 977894 n/a 977902 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977896 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977897 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association false false false Fig S1 I-J. Preoccupation of one binding site on DAAP with VEGF-A or Ang-2 further enhanced its binding activity to the other ligand- Ang-2 or VEGF-A. Neither VEFGA nor Ang-2 are explicitly stated to be tagged or CHO cell derived. vegfa-daap-flag_ang2 977894 n/a 977896 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977902 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977897 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association false false false Fig S1 L. DAAP is capable of simultaneously binding VEGF-A and Ang-2. vegfa165-vt-1 977895 n/a 977907 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977896 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig S1D. The binding affinity of DAAP to VEGF-A is roughly three times lower than that of VEGF-Trap to VEGF-A, whereas the binding affinity of DAAP to Ang-2 is roughly five times higher than that of Tie2-Fc to Ang-2. BIAcore analyses showed similar results (Figure S1D). The authors have not confirmed the VEGFA isoform used, nor its origin, nor if VEGFA is tagged or not. vegfa-daap5-1 977895 n/a 977897 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977896 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig S1D. The binding affinity of DAAP to VEGF-A is roughly three times lower than that of VEGF-Trap to VEGF-A, whereas the binding affinity of DAAP to Ang-2 is roughly five times higher than that of Tie2-Fc to Ang-2. BIAcore analyses showed similar results (Figure S1D). The authors have not confirmed the VEGFA isoform used, nor its origin, nor if VEGFA is tagged or not. ang2-tie2-1 977895 n/a 977908 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977902 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig S1D. The binding affinity of DAAP to VEGF-A is roughly three times lower than that of VEGF-Trap to VEGF-A, whereas the binding affinity of DAAP to Ang-2 is roughly five times higher than that of Tie2-Fc to Ang-2. BIAcore analyses showed similar results (Figure S1D). The authors have not confirmed the origin of Ang-2, nor if it is tagged or not. ang2-daap5-1 977895 n/a 977897 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 977902 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig S1D. The binding affinity of DAAP to VEGF-A is roughly three times lower than that of VEGF-Trap to VEGF-A, whereas the binding affinity of DAAP to Ang-2 is roughly five times higher than that of Tie2-Fc to Ang-2. BIAcore analyses showed similar results (Figure S1D). The authors have not confirmed the origin of Ang-2, nor if it is tagged or not.