IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ rustighi-2009-1 The prolyl-isomerase Pin1 is a Notch1 target that enhances Notch1 activation in cancer. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Rustighi A., Tiberi L., Soldano A., Napoli M., Nuciforo P., Rosato A., Kaplan F., Capobianco A., Pece S., Di Fiore P.P., Del Sal G. Cancer - Interactions investigated in the context of cancer details of pull-down method was found from Shen et al,. Genes Dev 1998, via Reference 14. The authors have confirmed that the GST-Pin1, and related contstructs, are Human in origin. delsal@lncib.it Nat. Cell Biol. (1465-7392) 2009 Only protein-protein interactions imex curation rustighi-2009-2 The prolyl-isomerase Pin1 is a Notch1 target that enhances Notch1 activation in cancer. human-skbr3 Homo sapiens SKBR3 skbr3 SKBR3 Species: human; Tissue: breast; Tumor: adenocarcinoma; Derived from: metastatic site: pleural effusion anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rustighi A., Tiberi L., Soldano A., Napoli M., Nuciforo P., Rosato A., Kaplan F., Capobianco A., Pece S., Di Fiore P.P., Del Sal G. Cancer - Interactions investigated in the context of cancer details of pull-down method was found from Shen et al,. Genes Dev 1998, via Reference 14. The authors have confirmed that the GST-Pin1, and related contstructs, are Human in origin. delsal@lncib.it Nat. Cell Biol. (1465-7392) 2009 Only protein-protein interactions imex curation rustighi-2009-4 The prolyl-isomerase Pin1 is a Notch1 target that enhances Notch1 activation in cancer. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Rustighi A., Tiberi L., Soldano A., Napoli M., Nuciforo P., Rosato A., Kaplan F., Capobianco A., Pece S., Di Fiore P.P., Del Sal G. Cancer - Interactions investigated in the context of cancer details of pull-down method was found from Shen et al,. Genes Dev 1998, via Reference 14. The authors have confirmed that the GST-Pin1, and related contstructs, are Human in origin. delsal@lncib.it Nat. Cell Biol. (1465-7392) 2009 Only protein-protein interactions imex curation rustighi-2009-5 The prolyl-isomerase Pin1 is a Notch1 target that enhances Notch1 activation in cancer. human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Rustighi A., Tiberi L., Soldano A., Napoli M., Nuciforo P., Rosato A., Kaplan F., Capobianco A., Pece S., Di Fiore P.P., Del Sal G. Cancer - Interactions investigated in the context of cancer details of pull-down method was found from Shen et al,. Genes Dev 1998, via Reference 14. The authors have confirmed that the GST-Pin1, and related contstructs, are Human in origin. delsal@lncib.it Nat. Cell Biol. (1465-7392) 2009 Only protein-protein interactions imex curation rustighi-2009-3 The prolyl-isomerase Pin1 is a Notch1 target that enhances Notch1 activation in cancer. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Rustighi A., Tiberi L., Soldano A., Napoli M., Nuciforo P., Rosato A., Kaplan F., Capobianco A., Pece S., Di Fiore P.P., Del Sal G. Cancer - Interactions investigated in the context of cancer details of pull-down method was found from Shen et al,. Genes Dev 1998, via Reference 14. Notch-1 was precipitated from SKBr-3 cells. Pin-1, and after blot-restripping, Notch-1, were detected by western blotting. The authors have confirmed that the GST-Pin1, and related contstructs, are Human in origin. delsal@lncib.it Nat. Cell Biol. (1465-7392) 2009 Only protein-protein interactions imex curation pin1_human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Rotamase Pin1 Peptidyl-prolyl cis-trans isomerase Pin1 PIN1 protein protein human Homo sapiens Human MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE notc1_human Neurogenic locus notch homolog protein 1 Translocation-associated notch protein TAN-1 NOTCH1 TAN1 protein protein human Homo sapiens Human MPPLLAPLLCLALLPALAARGPRCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSGTCLDKIDGYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNECNSNPCVHGACRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYSGRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLDLPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGPFTGPECQFPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFGGGAGRDIPPPLIEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGREEELRKHPIKRAAEGWAAPDALLGQVKASLLPGGSEGGRRRRELDPMDVRGSIVYLEIDNRQCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPAQLHFMYVAAAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALMDDNQNEWGDEDLETKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRMSAMAPTPPQGEVDADCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEYNLVRSPQLHGAPLGGTPTLSPPLCSPNGYLGSLKPGVQGKKVRKPSSKGLACGSKEAKDLKARRKKSQDGKGCLLDSSGMLSPVDSLESPHGYLSDVASPPLLPSPFQQSPSVPLNHLPGMPDTHLGIGHLNVAAKPEMAALGGGGRLAFETGPPRLSHLPVASGTSTVLGSSSGGALNFTVGGSTSLNGQCEWLSRLQSGMVPNQYNPLRGSVAPGPLSTQAPSLQHGMVGPLHSSLAASALSQMMSYQGLPSTRLATQPHLVQTQQVQPQNLQMQQQNLQPANIQQQQSLQPPPPPPQPHLGVSSAASGHLGRSFLSGEPSQADVQPLGPSSLAVHTILPQESPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK hes1_human_gene HES1 HUMAN GENE gene gene human Homo sapiens Human pin1_human_gene PIN1 Human Gene gene gene human Homo sapiens Human pin1-notch1 1287248 n/a 1287253 unspecified role unspecified role bait bait Q13526:p.Tyr23Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ww_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1287254 unspecified role unspecified role prey prey human-skbr3 Homo sapiens SKBR3 skbr3 SKBR3 Species: human; Tissue: breast; Tumor: adenocarcinoma; Derived from: metastatic site: pleural effusion physical association physical association false false false Fig 1B/S1 lambda phosphatase pin1-notch1-1 1287248 n/a 1287254 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells n/a 1287253 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 1B pin1-notch1-2 1287248 n/a 1287253 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1287254 unspecified role unspecified role prey prey human-mda_mb_468 Homo sapiens MDA-MB-468 mda_mb_468 MDA-MB-468 breast adenocarcinoma Species: human, Black; Tissue: breast; Tumor: adenocarcinoma; Derived from: pleural effusion physical association physical association false false false Fig 1B pin1-notch1-3 1287248 n/a 1287253 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1287254 unspecified role unspecified role prey prey human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma physical association physical association false false false Fig 1B pin1-notch1-4 1287249 n/a 1287253 unspecified role unspecified role bait bait n/a 1287254 unspecified role unspecified role prey prey physical association physical association false false false Fig 1C notch1-pin1 1287249 n/a 1287253 unspecified role unspecified role prey prey n/a 1287254 unspecified role unspecified role bait bait physical association physical association false false false Fig 1C pin1-notch1-6 1287250 n/a 1287253 unspecified role unspecified role bait bait ww_domain sufficient to bind sufficient binding region sufficient to bind range range range range false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1287254 unspecified role unspecified role prey prey n1_delta_e binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Fig 4 A/B The N1deltaE -Flag construct contains the Notch1 signal peptide and the intracellular domain. (deletion of most of the ECD). pin1-notch1-7 1287250 n/a 1287254 unspecified role unspecified role prey prey n1_delta_e_d2171 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P46531:p.[Ser2121Ala;Thr2132Ala;Ser2136Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P46531:p.[Ser2121Ala;Thr2132Ala;Ser2136Ala;Ser2141Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. n/a 1287253 unspecified role unspecified role bait bait ww_domain sufficient to bind sufficient binding region sufficient to bind range range range range false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 4 D/E The N1deltaE -Flag construct contains the Notch1 signal peptide and the intracellular domain. (deletion of most of the ECD). MAP/SAPK inhibitors. notch1-pin1-1 1287251 n/a 1287254 unspecified role unspecified role bait bait n/a 1287255 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6D gamma-secretase inhibitor notch1-hes1 1287251 n/a 1287256 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1287254 unspecified role unspecified role bait bait association association false false false Fig 6D gamma-secretase inhibitor pin1-notch1-5 1287252 n/a 1287253 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1287254 unspecified role unspecified role prey prey 1731_ha_tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag certain certain sequence position certain certain certain sequence position certain false n1_delta_e binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-skbr3 Homo sapiens SKBR3 skbr3 SKBR3 Species: human; Tissue: breast; Tumor: adenocarcinoma; Derived from: metastatic site: pleural effusion physical association physical association false false false Fig 1B The N1deltaE -Flag construct contains the Notch1 signal peptide and the intracellular domain. (deletion of most of the ECD).