IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ burgess-2008-1 Chfr interacts and colocalizes with TCTP to the mitotic spindle. xenla-oocyte Xenopus laevis oocyte Oocyte anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Burgess A., Labbe JC., Vigneron S., Bonneaud N., Strub JM., Van Dorsselaer A., Lorca T., Castro A. Cancer - Interactions investigated in the context of cancer The paper (PMID 6425302) by one of the authors confirmed that in this paper they used Xenopus laevis egg extracts. thierry.lorca@crbm.cnrs.fr,anna.castro@crbm.cnrs.fr Oncogene (0950-9232) 2008 Only protein-protein interactions imex curation burgess-2008-2 Chfr interacts and colocalizes with TCTP to the mitotic spindle. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Burgess A., Labbe JC., Vigneron S., Bonneaud N., Strub JM., Van Dorsselaer A., Lorca T., Castro A. Cancer - Interactions investigated in the context of cancer The paper (PMID 6425302) by one of the authors confirmed that in this paper they used Xenopus laevis egg extracts. thierry.lorca@crbm.cnrs.fr,anna.castro@crbm.cnrs.fr A cDNA library constructed with human mRNAs isolated from three complete 6- to 8-week-old human embryos was used. Oncogene (0950-9232) 2008 Only protein-protein interactions imex curation burgess-2008-3 Chfr interacts and colocalizes with TCTP to the mitotic spindle. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Burgess A., Labbe JC., Vigneron S., Bonneaud N., Strub JM., Van Dorsselaer A., Lorca T., Castro A. Cancer - Interactions investigated in the context of cancer The paper (PMID 6425302) by one of the authors confirmed that in this paper they used Xenopus laevis egg extracts. thierry.lorca@crbm.cnrs.fr,anna.castro@crbm.cnrs.fr Oncogene (0950-9232) 2008 Only protein-protein interactions imex curation burgess-2008-4 Chfr interacts and colocalizes with TCTP to the mitotic spindle. xenla-oocyte Xenopus laevis oocyte Oocyte molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Burgess A., Labbe JC., Vigneron S., Bonneaud N., Strub JM., Van Dorsselaer A., Lorca T., Castro A. Cancer - Interactions investigated in the context of cancer Gel filtration was carried out on interphase egg extracts. The paper (PMID 6425302) by one of the authors confirmed that in this paper they used Xenopus laevis egg extracts. thierry.lorca@crbm.cnrs.fr,anna.castro@crbm.cnrs.fr Oncogene (0950-9232) 2008 Only protein-protein interactions imex curation burgess-2008-5 Chfr interacts and colocalizes with TCTP to the mitotic spindle. xenla-oocyte Xenopus laevis oocyte Oocyte anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Burgess A., Labbe JC., Vigneron S., Bonneaud N., Strub JM., Van Dorsselaer A., Lorca T., Castro A. Cancer - Interactions investigated in the context of cancer The paper (PMID 6425302) by one of the authors confirmed that in this paper they used Xenopus laevis egg extracts. thierry.lorca@crbm.cnrs.fr,anna.castro@crbm.cnrs.fr Oncogene (0950-9232) 2008 Only protein-protein interactions imex curation burgess-2008-6 Chfr interacts and colocalizes with TCTP to the mitotic spindle. xenla-xl2 Xenopus laevis tadpole cell line XL2 xl2 Xenopus laevis tadpole cell line XL2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Burgess A., Labbe JC., Vigneron S., Bonneaud N., Strub JM., Van Dorsselaer A., Lorca T., Castro A. Cancer - Interactions investigated in the context of cancer The paper (PMID 6425302) by one of the authors confirmed that in this paper they used Xenopus laevis egg extracts. thierry.lorca@crbm.cnrs.fr,anna.castro@crbm.cnrs.fr Oncogene (0950-9232) 2008 Only protein-protein interactions imex curation chfr_xenla E3 ubiquitin-protein ligase CHFR chfr Checkpoint with forkhead and RING finger domains protein RING-type E3 ubiquitin transferase CHFR protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MEGLDEKKPWGKLSRLLGAETDSSSELFLYKKEWTIGRKKACDLSFPGNKLVSGEHCKITVNEESGEVSLEDTSTNGTVINKLKVIRKQTYPLKNGDVIYVVYRKNEPEQNVAYLYKSLNQGQDSLHDPADTSGSEEAETQTLSSQDDQLSYEEPQPSTSTSSLFSTPTTSAIPGVQLESAEKSGESLGGHSSTSDASPAIRASIPKSNLSTQEQGSLGPPKKRIRTEDHWTTNKNFVPASCPIGASDESKTPSMKPDKMEETLTCIICQELLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERICKNHILNNLVEAYLIQHPEKCRSEEDRCSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDISQPYTVCRQCPGFVRHSMQPPPYPPPSDTETSRTQGDAPSTSTNFPTATQEYVCPSHGSHVICTCCFQPMPDRRAEREHNSHVAPQQCTICLEPFCHMYWGCNRMGCFGCLAPFCELNLGDKCLDGVLNNNNYESDILKNYLASRGLTWKDMLNESLAAVQRGVFMLPDYRINGTTVLCYFCGLRNFRILTYQYRQNIPASELPVTVTSRPNCYWGRNCRTQVKAHHAMKFNHICEQTRFKN ubiqp_xenla Polyubiquitin protein protein xenla Xenopus laevis (African clawed frog) African clawed frog QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG tctp_human Translationally-controlled tumor protein TPT1 p23 Histamine-releasing factor Fortilin protein protein human Homo sapiens Human MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC chfr_human E3 ubiquitin-protein ligase CHFR Checkpoint with forkhead and RING finger domains protein RING finger protein 196 CHFR RNF196 RING-type E3 ubiquitin transferase CHFR protein protein human Homo sapiens Human MERPEEGKQSPPPQPWGRLLRLGAEEGEPHVLLRKREWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQVTLEDTSTSGTVINKLKVVKKQTCPLQTGDVIYLVYRKNEPEHNVAYLYESLSEKQGMTQESFEANKENVFHGTKDTSGAGAGRGADPRVPPSSPATQVCFEEPQPSTSTSDLFPTASASSTEPSPAGRERSSSCGSGGGGISPKGSGPSVASDEVSSFASALPDRKTASFSSLEPQDQEDLEPVKKKMRGDGDLDLNGQLLVAQPRRNAQTVHEDVRAAAGKPDKMEETLTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERICKNHILNNLVEAYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDISQPYVVCRQCPEYRRQAAQPPHCPAPEGEPGAPQALGDAPSTSVSLTTAVQDYVCPLQGSHALCTCCFQPMPDRRAEREQDPRVAPQQCAVCLQPFCHLYWGCTRTGCYGCLAPFCELNLGDKCLDGVLNNNSYESDILKNYLATRGLTWKNMLTESLVALQRGVFLLSDYRVTGDTVLCYCCGLRSFRELTYQYRQNIPASELPVAVTSRPDCYWGRNCRTQVKAHHAMKFNHICEQTRFKN tctp_xenla Translationally-controlled tumor protein homolog tpt1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MIIYKDCITEDEMFSDIYKIIETPDGMCLEVEGKVIQREEGAIDDALIGGNASAEFQEDDVGGSSLTSGVDIVMNHKLQETGFTKDSYKNYIKDYVKQLKAHLEKTNPERVNTFMKGAQETVKKILGNFKNYQFYTGERMNPDGMVGLLDYREDGITPFMIFFKDGLIIEKC chfr-ubiq Chfr is ubiquitinated in metaphase II-arrested Xenopus egg extracts 741333 N/A 741339 unspecified role unspecified role bait bait N/A 741340 unspecified role unspecified role prey prey physical association physical association false false false 1 B chfr-tctp CHFR interacts with TCTP in a yeast two-hybrid assay 741334 N/A 741341 unspecified role unspecified role prey prey N/A 741342 unspecified role unspecified role bait bait physical association physical association false false false chfr-tctp-1 CHFR interacts with TCTP in a directed yeast two-hybrid assay 741335 N/A 741342 unspecified role unspecified role bait bait N/A 741341 unspecified role unspecified role prey prey physical association physical association false false false chfr-tctp-2 In a gel filtration assay on interphase Xenopus egg extracts Chfr co-eluted with Tpt1 (TCTP) 741336 N/A 741343 unspecified role unspecified role neutral component neutral component N/A 741339 unspecified role unspecified role neutral component neutral component physical association physical association false false false 5 B chfr-tctp-3 Chfr coimmunoprecipitates Tctp in metaphase II-arrested Xenopus egg extracts (CSF) 741337 N/A 741343 unspecified role unspecified role prey prey N/A 741339 unspecified role unspecified role bait bait physical association physical association false false false 5 C chfr-tctp-4 Chfr coimmunoprecipitates Tctp in XL2 extracts 741338 N/A 741343 unspecified role unspecified role prey prey N/A 741339 unspecified role unspecified role bait bait physical association physical association false false false 5 C