IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wang-2008a-3 TNF-alpha induces two distinct caspase-8 activation pathways. human-panc1 Homo sapiens pancreatic carcinoma cell line PANC-1 panc1 Human pancreatic carcinoma cell line PANC-1 Established from a pancreatic carcinoma of ductal origin from a 56-year-old Caucasian male. Cells possess the type B phenotype for G6PD. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang L., Du F., Wang X. Apoptosis - Interactions involving proteins with a function related to apoptosis The H2009 cells used were stably transfected with a tetracycline-inducible RIPK1-shRNA construct. Cells were treated with TNF-alpha, Smac mimetic and z-VAD or not. The source of the TNF-alpha construct and the cIAP1 construct could not be determined and thus interactions involving these proteins as interactors have not been curated. xiaodong.wang@utsouthwestern.edu Cell (0092-8674) 2008 Only protein-protein interactions 4 imex curation Cancer - Interactions investigated in the context of cancer wang-2008a-1 TNF-alpha induces two distinct caspase-8 activation pathways. human-h2009 Homo sapiens H2009 non-small cell lung carcinoma cell line h2009 Human non-small cell lung carcinoma cell line H2009 Rb-negative cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang L., Du F., Wang X. Apoptosis - Interactions involving proteins with a function related to apoptosis The H2009 cells used were stably transfected with a tetracycline-inducible RIPK1-shRNA construct. Cells were treated with TNF-alpha, Smac mimetic and z-VAD or not. xiaodong.wang@utsouthwestern.edu Cell (0092-8674) 2008 Only protein-protein interactions 4 imex curation Cancer - Interactions investigated in the context of cancer wang-2008a-2 TNF-alpha induces two distinct caspase-8 activation pathways. human-panc1 Homo sapiens pancreatic carcinoma cell line PANC-1 panc1 Human pancreatic carcinoma cell line PANC-1 Established from a pancreatic carcinoma of ductal origin from a 56-year-old Caucasian male. Cells possess the type B phenotype for G6PD. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang L., Du F., Wang X. Apoptosis - Interactions involving proteins with a function related to apoptosis The H2009 cells used were stably transfected with a tetracycline-inducible RIPK1-shRNA construct. Cells were treated with TNF-alpha, Smac mimetic and z-VAD or not. xiaodong.wang@utsouthwestern.edu Cell (0092-8674) 2008 Only protein-protein interactions 4 imex curation Cancer - Interactions investigated in the context of cancer casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS ripk1_human Receptor-interacting serine/threonine-protein kinase 1 RIPK1 RIP Cell death protein RIP RIP1 Receptor-interacting protein 1 protein protein human Homo sapiens Human MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEALLEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIILEIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVDGTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMCIKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEEDVKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN casp8-fadd-3 Caspase-8 interacts with FADD and RIPK1 in PANC-1 lysates 739548 N/A 739551 unspecified role unspecified role bait bait N/A 739552 unspecified role unspecified role prey prey N/A 739553 unspecified role unspecified role prey prey association association false false false 5 D, E, F These interactions occurred in cells treated with TNF-alpha, Smac mimetic and z-VAD. The authors comment that 'only a small fraction of RIPK1 and FADD from the total cellular pool was associated with caspase-8 after the TNF-a plus Smac mimetic treatment'. Gel filtration of eluted caspase-8 complex, and further coimmunoprecipitation with FADD, showed that most caspase-8 is not in complex with FADD and RIPK1. casp8-fadd-4 Caspase-8 interacts with FADD in PANC-1 lysates 739548 N/A-x 739551 unspecified role unspecified role bait bait N/A-x 739552 unspecified role unspecified role prey prey physical association physical association false false false S14 These interactions occurred in cells treated with TNF-alpha, Smac mimetic and z-VAD to a greater extent than if cycloheximide was used instead of Smac mimetic. casp8-fadd Caspase-8 interacts with FADD and RIPK1 in H2009 lysates 739549 N/A 739552 unspecified role unspecified role prey prey N/A 739553 unspecified role unspecified role prey prey N/A 739551 unspecified role unspecified role bait bait association association false false false 5 B Caspase-8 no longer interacts with FADD when RIPK1-shRNA is induced. These interactions occurred in cells treated with TNF-alpha, Smac mimetic and z-VAD. The interaction between caspase-8 and FADD was markedly decreased in cells expressing K45A kinase dead mutant RIPK1. In another experiment the Lys45Ala mutation in RIPK1 abolished the interaction of RIPK1 with these proteins. casp8-fadd-2 Caspase-8 interacts with FADD and RIPK1 in PANC-1 lysates 739550 N/A 739553 unspecified role unspecified role prey prey N/A 739552 unspecified role unspecified role prey prey N/A 739551 unspecified role unspecified role bait bait association association false false false S8, 6 D These interactions occurred in cells treated with TNF-alpha, Smac mimetic and z-VAD for 2 h. Knockdown of TRADD enhanced these interactions. Knockdown of cIAP1 and cIAP2 enabled the caspase-8/FADD/RIPK1 interaction in the absence of Smac mimetic.