IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ huo-2008-2 Interaction with Ppil3 leads to the cytoplasmic localization of Apoptin in tumor cells. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Huo DH., Yi LN., Yang J. Apoptosis - Interactions involving proteins with a function related to apoptosis lssyje@mail.sysu.edu.cn A human ovary cDNA library was used. Biochem. Biophys. Res. Commun. (0006-291X) 2008 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer huo-2008-1 Interaction with Ppil3 leads to the cytoplasmic localization of Apoptin in tumor cells. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Huo DH., Yi LN., Yang J. Apoptosis - Interactions involving proteins with a function related to apoptosis lssyje@mail.sysu.edu.cn A human ovary cDNA library was used. Biochem. Biophys. Res. Commun. (0006-291X) 2008 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer ppil3_human Peptidyl-prolyl cis-trans isomerase-like 3 Cyclophilin-like protein PPIL3 Cyclophilin J PPIL3 Rotamase PPIL3 protein protein human Homo sapiens Human MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFAQ vp3_cavc1 Apoptin VP3 protein protein cavc1 Chicken anemia virus (isolate Germany Cuxhaven-1) (CAV) MNALQEDTPPGPSTVFRPPTSSRPLETPHCREIRIGIAGITITLSLCGCANARAPTLRSATADNSESTGFKNVPDLRTDQPKPPSKKRSCDPSEYRVSELKESLITTTPSRPRTAKRRIRL vp3-ppil3-1 Apoptin pulls down PPIL3 in vitro 739329 N/A 739331 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 739332 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false There are a number of UniProtKB entries corresponding to chicken anemia virus Apoptin. These correspond to different isolates of the virus. The first entry obtained was used. 1 ppil3-vp3 PPIL3 pulls down Apoptin in vitro 739329 N/A 739332 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 739331 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false There are a number of UniProtKB entries corresponding to chicken anemia virus Apoptin. These correspond to different isolates of the virus. The first entry obtained was used. 1 vp3-ppil3 Apoptin interacts with PPIL3 in a yeast two-hybrid assay 739330 N/A 739332 unspecified role unspecified role bait bait N/A 739331 unspecified role unspecified role prey prey physical association physical association false false false There are a number of UniProtKB entries corresponding to chicken anemia virus Apoptin. These correspond to different isolates of the virus. The first entry obtained was used.