IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ chen-2008-1 Inhibition of endoplasmic reticulum stress-induced apoptosis of melanoma cells by the ARC protein. human-me1007 Homo sapiens Me1007 melanoma cell line me1007 Human Me1007 melanoma cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chen LH., Jiang CC., Watts R., Thorne RF., Kiejda KA., Zhang XD., Hersey P. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of ARC taken from PMID 9560245. Peter.Hersey@newcastle.edu.au,Xu.Zhang@newcastle.edu.au Cancer Res. (0008-5472) 2008 Cancer - Interactions investigated in the context of cancer chen-2008-2 Inhibition of endoplasmic reticulum stress-induced apoptosis of melanoma cells by the ARC protein. human-mel_rm Homo sapiens melanoma cell line MEL-RM mel_rm Human melanoma cell line MEL-RM anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen LH., Jiang CC., Watts R., Thorne RF., Kiejda KA., Zhang XD., Hersey P. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of ARC taken from PMID 9560245. Peter.Hersey@newcastle.edu.au,Xu.Zhang@newcastle.edu.au Cancer Res. (0008-5472) 2008 Cancer - Interactions investigated in the context of cancer chen-2008-3 Inhibition of endoplasmic reticulum stress-induced apoptosis of melanoma cells by the ARC protein. human-mm200 Homo sapiens melanoma cell line MM200 mm200 Human melanoma cell line MM200 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen LH., Jiang CC., Watts R., Thorne RF., Kiejda KA., Zhang XD., Hersey P. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of ARC taken from PMID 9560245. Peter.Hersey@newcastle.edu.au,Xu.Zhang@newcastle.edu.au Cancer Res. (0008-5472) 2008 Cancer - Interactions investigated in the context of cancer casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD nol3_human Nucleolar protein 3 Apoptosis repressor with CARD Muscle-enriched cytoplasmic protein Nucleolar protein of 30 kDa NOL3 ARC NOP protein protein human Homo sapiens Human MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS nol3-casp8 NOL3 (ARC) coimmunoprecipitates caspase-8 in Me1007 lysates 733524 N/A 733527 unspecified role unspecified role prey prey N/A 733528 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false O60936 transfection Thapsigargin - This interaction occurred after treatment of cells with thapsigargin. Tunicamycin - This interaction occurred after treatment of cells with tunicamycin. 4 C casp8-nol3 NOL3 (ARC) coimmunoprecipitates caspase-8 in MEL-RM lysates 733525 N/A 733527 unspecified role unspecified role bait bait N/A 733528 unspecified role unspecified role prey prey physical association physical association false false false 4 D This interaction occurred both before and after exposure to thapsigargin or tunicamycin. casp8-nol3-1 NOL3 (ARC) coimmunoprecipitates caspase-8 in MM200 lysates 733526 N/A 733527 unspecified role unspecified role bait bait N/A 733528 unspecified role unspecified role prey prey physical association physical association false false false 4 D This interaction occurred both before and after exposure to thapsigargin or tunicamycin.