IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ bohgaki-2007-1 Involvement of Ymer in suppression of NF-kappaB activation by regulated interaction with lysine-63-linked polyubiquitin chain. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bohgaki M., Tsukiyama T., Nakajima A., Maruyama S., Watanabe M., Koike T., Hatakeyama S. Cancer - Interactions investigated in the context of cancer hatas@med.hokudai.ac.jp A human B cell Matchmaker cDNA library (Clontech) was used. Biochim. Biophys. Acta (0006-3002) 2007 bohgaki-2007-5 Involvement of Ymer in suppression of NF-kappaB activation by regulated interaction with lysine-63-linked polyubiquitin chain. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Bohgaki M., Tsukiyama T., Nakajima A., Maruyama S., Watanabe M., Koike T., Hatakeyama S. Cancer - Interactions investigated in the context of cancer hatas@med.hokudai.ac.jp A human B cell Matchmaker cDNA library (Clontech) was used. Biochim. Biophys. Acta (0006-3002) 2007 bohgaki-2007-2 Involvement of Ymer in suppression of NF-kappaB activation by regulated interaction with lysine-63-linked polyubiquitin chain. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Bohgaki M., Tsukiyama T., Nakajima A., Maruyama S., Watanabe M., Koike T., Hatakeyama S. Cancer - Interactions investigated in the context of cancer hatas@med.hokudai.ac.jp A human B cell Matchmaker cDNA library (Clontech) was used. Biochim. Biophys. Acta (0006-3002) 2007 bohgaki-2007-3 Involvement of Ymer in suppression of NF-kappaB activation by regulated interaction with lysine-63-linked polyubiquitin chain. human-jurkat Homo sapiens jurkat Human T cell leukemia anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bohgaki M., Tsukiyama T., Nakajima A., Maruyama S., Watanabe M., Koike T., Hatakeyama S. Cancer - Interactions investigated in the context of cancer hatas@med.hokudai.ac.jp A human B cell Matchmaker cDNA library (Clontech) was used. Biochim. Biophys. Acta (0006-3002) 2007 bohgaki-2007-4 Involvement of Ymer in suppression of NF-kappaB activation by regulated interaction with lysine-63-linked polyubiquitin chain. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging polyclonal immunost polyclonal antibody immunostaining polyclonal immunost Bohgaki M., Tsukiyama T., Nakajima A., Maruyama S., Watanabe M., Koike T., Hatakeyama S. Cancer - Interactions investigated in the context of cancer hatas@med.hokudai.ac.jp A human B cell Matchmaker cDNA library (Clontech) was used. Biochim. Biophys. Acta (0006-3002) 2007 ccd50_human Coiled-coil domain-containing protein 50 Protein Ymer CCDC50 C3orf6 protein protein human Homo sapiens Human MAEVSIDQSKLPGVKEVCRDFAVLEDHTLAHSLQEQEIEHHLASNVQRNRLVQHDLQVAKQLQEEDLKAQAQLQKRYKDLEQQDCEIAQEIQEKLAIEAERRRIQEKKDEDIARLLQEKELQEEKKRKKHFPEFPATRAYADSYYYEDGGMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQVAQDEEIARLLMAEEKKAYKKAKEREKSSLDKRKQDPEWKPKTAKAANSKSKESDEPHHSKNERPARPPPPIMTDGEDADYTHFTNQQSSTRHFSKSESSHKGFHYKH otu7b_human OTU domain-containing protein 7B Zinc finger protein Cezanne Zinc finger A20 domain-containing protein 1 Cellular zinc finger anti-NF-kappa-B protein OTUD7B ZA20D1 protein protein human Homo sapiens Human MTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDVNAALSDFEQLRQVHAGNLPPSFSEGSGGSRTPEKGFSDREPTRPPRPILQRQDDIVQEKRLSRGISHASSSIVSLARSHVSSNGGGGGSNEHPLEMPICAFQLPDLTVYNEDFRSFIERDLIEQSMLVALEQAGRLNWWVSVDPTSQRLLPLATTGDGNCLLHAASLGMWGFHDRDLMLRKALYALMEKGVEKEALKRRWRWQQTQQNKESGLVYTEDEWQKEWNELIKLASSEPRMHLGTNGANCGGVESSEEPVYESLEEFHVFVLAHVLRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPASQCHRSPLVLAYDQAHFSALVSMEQKENTKEQAVIPLTDSEYKLLPLHFAVDPGKGWEWGKDDSDNVRLASVILSLEVKLHLLHSYMNVKWIPLSSDAQAPLAQPESPTASAGDEPRSTPESGDSDKESVGSSSTSNEGGRRKEKSKRDREKDKKRADSVANKLGSFGKTLGSKLKKNMGGLMHSKGSKPGGVGTGLGGSSGTETLEKKKKNSLKSWKGGKEEAAGDGPVSEKPPAESVGNGGSKYSQEVMQSLSILRTAMQGEGKFIFVGTLKMGHRHQYQEEMIQRYLSDAEERFLAEQKQKEAERKIMNGGIGGGPPPAKKPEPDAREEQPTGPPAESRAMAFSTGYPGDFTIPRPSGGGVHCQEPRRQLAGGPCVGGLPPYATFPRQCPPGRPYPHQDSIPSLEPGSHSKDGLHRGALLPPPYRVADSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYGHPETNNFCSCCYREELRRREREPDGELLVHRF 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN tnip2_human TNFAIP3-interacting protein 2 TNIP2 ABIN2 FLIP1 Fetal liver LKB1-interacting protein A20-binding inhibitor of NF-kappa-B activation 2 protein protein human Homo sapiens Human MSRDPGSGGWEEAPRAAAALCTLYHEAGQRLRRLQDQLAARDALIARLRARLAALEGDAAPSLVDALLEQVARFREQLRRQEGGAAEAQMRQEIERLTERLEEKEREMQQLLSQPQHEREKEVVLLRRSMAEGERARAASDVLCRSLANETHQLRRTLTATAHMCQHLAKCLDERQHAQRNVGERSPDQSEHTDGHTSVQSVIEKLQEENRLLKQKVTHVEDLNAKWQRYNASRDEYVRGLHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQELAASRTARDAALERVQMLEQQILAYKDDFMSERADRERAQSRIQELEEKVASLLHQVSWRQDSREPDAGRIHAGSKTAKYLAADALELMVPGGWRPGTGSQQPEPPAEGGHPGAAQRGQGDLQCPHCLQCFSDEQGEELLRHVAECCQ ubb_human Polyubiquitin-B UBB protein protein human Homo sapiens Human MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC ripk1_human Receptor-interacting serine/threonine-protein kinase 1 RIPK1 RIP Cell death protein RIP RIP1 Receptor-interacting protein 1 protein protein human Homo sapiens Human MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEALLEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIILEIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVDGTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMCIKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEEDVKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN otud7b-ccdc50 OTUD7B (A20) interacts with CCDC50 (Ymer) in a yeast two-hybrid assay 733379 N/A 733384 unspecified role unspecified role prey prey N/A 733385 unspecified role unspecified role bait bait physical association physical association false false false PREY gene AJ416916 otud7b-ywhab OTUD7B (A20) interacts with YWHAB (14-3-3 alpha) in a yeast two-hybrid assay 733379 N/A 733385 unspecified role unspecified role bait bait N/A 733386 unspecified role unspecified role prey prey physical association physical association false false false otud7b-tnip2 OTUD7B (A20) interacts with TNIP2 (ABIN-1/2) in a yeast two-hybrid assay 733379 N/A 733385 unspecified role unspecified role bait bait N/A 733387 unspecified role unspecified role prey prey physical association physical association false false false ccdc50-rps27a Ubiquitin interacts with CCDC50 (Ymer) in a yeast two-hybrid assay 733379 N/A 733384 unspecified role unspecified role bait bait N/A 733388 unspecified role unspecified role prey prey physical association physical association false false false BAIT gene AJ416916 ccdc50-rps27a-1 CCDC50 (Ymer) pulls down Ubiquitin in vitro 733380 N/A 733384 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q8IVM0:p.Leu116Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 733388 unspecified role unspecified role prey prey physical association physical association false false false BAIT gene AJ416916 2 otud7b-rps27a OTUD7B (A20) pulls down Ubiquitin in vitro 733380 N/A 733384 unspecified role unspecified role ancillary ancillary N/A 733388 unspecified role unspecified role prey prey N/A 733385 unspecified role unspecified role bait bait association association false false false ANCILLARY gene AJ416916 3 B OTUD7b (A20) associates with K63 polyubiquItin chain. This interaction is enhanced by the presence of CCDC50 (Ymer), which suggests CCDC50 may act as a scaffold between the two. ccdc50-ripk1-1 CCDC50 (Ymer) pulls down RIPK1 (RIP1) in vitro 733380 N/A 733389 unspecified role unspecified role prey prey N/A 733384 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false BAIT gene AJ416916 4 F CCDC50 (Ymer) interacts with RIP1 whether RIP1 is ubiquitinated or not. ccdc50-otud7b-1 OTUD7B (A20) coimmunoprecipitates with CCDC50 (Ymer) in HEK293T lysates 733381 N/A 733384 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 733385 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false BAIT gene AJ416916 1 A, D, E, F, 3 A Q6GQQ9; Q8IVM0 transfection ccdc50-ripk1 CCDC50 (Ymer) coimmunoprecipitates RIPK1 (RIP1) in HEK293T lysates 733381 N/A 733384 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 733389 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT gene AJ416916 Q13546; Q8IVM0 transfection 4 A, D ccdc50-otud7b Endogenous OTUD7B (A20) coimmunoprecipitates with endogenous CCDC50 (Ymer) in Jurkat lysates 733382 N/A 733384 unspecified role unspecified role bait bait N/A 733385 unspecified role unspecified role prey prey physical association physical association false false false BAIT gene AJ416916 1 B ccdc50-otud7b-2 OTUD7B (A20) and CCDC50 (Ymer) colocalize in HeLa cells 733383 N/A 733384 unspecified role unspecified role neutral component neutral component N/A 733385 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Q8IVM0 gene AJ416916 1 C