IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ brieger-2007-2 Thymosin beta 4 expression and nuclear transport are regulated by hMLH1. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Brieger A., Plotz G., Zeuzem S., Trojan J. Cancer - Interactions investigated in the context of cancer a.brieger@em.uni-frankfurt.de A human colon cDNA library was used. Biochem. Biophys. Res. Commun. (0006-291X) 2007 Only protein-protein interactions imex curation brieger-2007-3 Thymosin beta 4 expression and nuclear transport are regulated by hMLH1. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunostaining immunostaining Brieger A., Plotz G., Zeuzem S., Trojan J. Cancer - Interactions investigated in the context of cancer The authors supplied by email the residues mutated in the nuclear localization signal of hMLH1. a.brieger@em.uni-frankfurt.de A human colon cDNA library was used. Biochem. Biophys. Res. Commun. (0006-291X) 2007 Only protein-protein interactions imex curation brieger-2007-1 Thymosin beta 4 expression and nuclear transport are regulated by hMLH1. ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Brieger A., Plotz G., Zeuzem S., Trojan J. Cancer - Interactions investigated in the context of cancer a.brieger@em.uni-frankfurt.de A human colon cDNA library was used. Biochem. Biophys. Res. Commun. (0006-291X) 2007 Only protein-protein interactions imex curation mlh1_human DNA mismatch repair protein Mlh1 MutL protein homolog 1 MLH1 COCA2 protein protein human Homo sapiens Human MSFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC tyb4_human Thymosin beta-4 Fx TMSB4X TB4X THYB4 TMSB4 protein protein human Homo sapiens Human MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES tmsb4x-mlh1 Thymosin beta 4 coimmunoprecipitates hMLH1 in 293T lysates 684012 N/A 684015 unspecified role unspecified role prey prey N/A 684016 unspecified role unspecified role bait bait physical association physical association false false false 1 P62328; P40692 transfection mlh1-tmsb4x Thymosin beta 4 coimmunoprecipitates with hMLH1 in 293T lysates 684012 N/A 684015 unspecified role unspecified role bait bait N/A 684016 unspecified role unspecified role prey prey physical association physical association false false false 1 P62328; P40692 transfection mlh1-tmsb4x-1 Endogenous Thymosin beta 4 coimmunoprecipitates with hMLH1 in 293T lysates 684012 N/A 684016 unspecified role unspecified role prey prey N/A 684015 unspecified role unspecified role bait bait physical association physical association false false false 1 P40692 transfection tmsb4x-mlh1-3 Endogenous Thymosin beta 4 coimmunoprecipitates endogenous hMLH1 in 293T lysates from cells treated with 5-Aza-CdR 684012 N/A 684016 unspecified role unspecified role bait bait N/A 684015 unspecified role unspecified role prey prey physical association physical association false false false 1 5-aza-2'-deoxycytidine (5-Aza-CdR) - This interaction is enhanced by treatment of cells with 5-Aza-CdR, which restored hMLH1 expression in 293T cells by demethylation of the hMLH1 promoter. tmsb4x-mlh1-1 Endogenous Thymosin beta 4 coimmunoprecipitates hMLH1 in 293T lysates 684012 N/A 684015 unspecified role unspecified role prey prey N/A 684016 unspecified role unspecified role bait bait physical association physical association false false false 1 P40692 transfection mlh1-tmsb4x-2 Endogenous Thymosin beta 4 coimmunoprecipitates with endogenous hMLH1 in 293T lysates from cells treated with 5-Aza-CdR 684012 N/A 684015 unspecified role unspecified role bait bait N/A 684016 unspecified role unspecified role prey prey physical association physical association false false false 1 5-aza-2'-deoxycytidine (5-Aza-CdR) - This interaction is enhanced by treatment of cells with 5-Aza-CdR, which restored hMLH1 expression in 293T cells by demethylation of the hMLH1 promoter. mlh1-tmsb4x-3 Exogenous hMLH1 colocalizes with Thymosin beta 4 in 293T cells 684013 N/A 684015 unspecified role unspecified role neutral component neutral component N/A 684016 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2 P40692 transfection When the NLS (nuclear localization signal) of hMLH1 was mutated (K471N or R472G), hMLH1 and thymosin beta 4 remained in the cytoplasm, which indicates that translocation of thymosin beta 4 relies on interaction with hMLH1 harboring a functional NLS. mlh1-tmsb4x-4 Endogenous hMLH1 colocalizes with endogenous Thymosin beta 4 in 293T cells treated with 5-Aza-CdR 684013 N/A 684016 unspecified role unspecified role neutral component neutral component N/A 684015 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2 5-aza-2'-deoxycytidine (5-Aza-CdR) - This interaction is enhanced by treatment of cells with 5-Aza-CdR, which restored hMLH1 expression in 293T cells by demethylation of the hMLH1 promoter. mlh1-tmsb4x0 hMLH1 interacts with thymosin beta 4 in a bacterial two-hybrid assay 684014 N/A 684015 unspecified role unspecified role bait bait N/A 684016 unspecified role unspecified role prey prey physical association physical association false false false