IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ park-2007-1 Peroxiredoxin 1 interacts with androgen receptor and enhances its transactivation. human-ln3 Homo sapiens androgen-sensitive and highly metastatic human prostate cancer cell line LN3 ln3 Human androgen-sensitive and highly metastatic human prostate cancer cell line LN3 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Park SY., Yu X., Ip C., Mohler JL., Bogner PN., Park YM. Cancer - Interactions investigated in the context of cancer young-mee.park@roswellpark.org Cancer Res. (0008-5472) 2007 park-2007-2 Peroxiredoxin 1 interacts with androgen receptor and enhances its transactivation. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Park SY., Yu X., Ip C., Mohler JL., Bogner PN., Park YM. Cancer - Interactions investigated in the context of cancer Reference 22 (PMID 16707435) refers to the PMID 8643607 as reference 36, which specifies that the androgen construct is of human origin. young-mee.park@roswellpark.org Cancer Res. (0008-5472) 2007 andr_human Androgen receptor Dihydrotestosterone receptor Nuclear receptor subfamily 3 group C member 4 AR DHTR NR3C4 protein protein human Homo sapiens Human MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQQQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPYGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ prdx1_human Peroxiredoxin-1 PRDX1 PAGA PAGB TDPX2 Thioredoxin peroxidase 2 Thioredoxin-dependent peroxide reductase 2 Proliferation-associated gene protein Natural killer cell-enhancing factor A Thioredoxin-dependent peroxiredoxin 1 protein protein human Homo sapiens Human MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK prdx1-ar Peroxiredoxin 1 coimmunoprecipitates androgen receptor from LN3 lysates 672222 N/A 672224 unspecified role unspecified role prey prey N/A 672225 unspecified role unspecified role bait bait physical association physical association false false false 6 A Hypoxia/reoxygenation - This interaction was enhanced when LN3 cells were treated with 4 h hypoxia/2 h reoxygenation. ar-prdx1 Peroxiredoxin 1 coimmunoprecipitates with androgen receptor from LN3 lysates 672222 N/A 672225 unspecified role unspecified role prey prey N/A 672224 unspecified role unspecified role bait bait physical association physical association false false false 6 A Hypoxia/reoxygenation - This interaction was enhanced when LN3 cells were treated with 4 h hypoxia/2 h reoxygenation. prdx1-ar-1 Peroxiredoxin 1 pulls down Androgen Receptor in vitro 672223 N/A 672225 unspecified role unspecified role bait bait N/A 672224 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false 6 C In pull-down assays using Prx1 C52S or in vitro oxidized Prx1, similar interactions between AR and these Prx1 proteins lacking antioxidant activity were observed.