IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ jones-2007-3 A CDKN2A mutation in familial melanoma that abrogates binding of p16INK4a to CDK4 but not CDK6. human-hs68 Homo sapiens Hs68 normal diploid foreskin fibroblasts hs68 Human Hs68 normal diploid foreskin fibroblasts anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Jones R., Ruas M., Gregory F., Moulin S., Delia D., Manoukian S., Rowe J., Brookes S., Peters G. Apoptosis - Interactions involving proteins with a function related to apoptosis To enhance expression of p14ARF, cells were infected with a recombinant retrovirus encoding an ER-E2F1 fusion protein. Upon addition of 4-hydroxy tamoxifen to activate E2F1 expression, p14ARF became detectable by immunoblotting. gordon.peters@cancer.org.uk Cancer Res. (0008-5472) 2007 IMEx Cancer - Interactions investigated in the context of cancer Only protein-protein interactions imex curation imex curation jones-2007-6 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jones R., Ruas M., Gregory F., Moulin S., Delia D., Manoukian S., Rowe J., Brookes S., Peters G. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.peters@cancer.org.uk Cancer Res. (0008-5472) 2007 IMEx Cancer - Interactions investigated in the context of cancer To enhance expression of p14ARF, cells were infected with a recombinant retrovirus encoding an ER-E2F1 fusion protein. Upon addition of 4-hydroxy tamoxifen to activate E2F1 expression, p14ARF became detectable by immunoblotting. Only protein-protein interactions imex curation imex curation jones-2007-1 A CDKN2A mutation in familial melanoma that abrogates binding of p16INK4a to CDK4 but not CDK6. human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast Resident cell of connective tissue, mesodermally derived anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Jones R., Ruas M., Gregory F., Moulin S., Delia D., Manoukian S., Rowe J., Brookes S., Peters G. Apoptosis - Interactions involving proteins with a function related to apoptosis To enhance expression of p14ARF, cells were infected with a recombinant retrovirus encoding an ER-E2F1 fusion protein. Upon addition of 4-hydroxy tamoxifen to activate E2F1 expression, p14ARF became detectable by immunoblotting. Cells - human diploid fibroblasts gordon.peters@cancer.org.uk Cancer Res. (0008-5472) 2007 IMEx Cancer - Interactions investigated in the context of cancer To enhance expression of p14ARF, cells were infected with a recombinant retrovirus encoding an ER-E2F1 fusion protein. Upon addition of 4-hydroxy tamoxifen to activate E2F1 expression, p14ARF became detectable by immunoblotting. Only protein-protein interactions imex curation imex curation jones-2007-2 A CDKN2A mutation in familial melanoma that abrogates binding of p16INK4a to CDK4 but not CDK6. human-milan_df Homo sapiens primary diploid skin fibroblasts homozygous for the R24P mutation in p16INK4A milan_df Human Milan diploid fibroblasts A culture of primary skin fibroblasts from a biopsy of a patient homozygous for the R24P mutation in p16INK4A anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jones R., Ruas M., Gregory F., Moulin S., Delia D., Manoukian S., Rowe J., Brookes S., Peters G. Apoptosis - Interactions involving proteins with a function related to apoptosis To enhance expression of p14ARF, cells were infected with a recombinant retrovirus encoding an ER-E2F1 fusion protein. Upon addition of 4-hydroxy tamoxifen to activate E2F1 expression, p14ARF became detectable by immunoblotting. gordon.peters@cancer.org.uk Cancer Res. (0008-5472) 2007 IMEx Cancer - Interactions investigated in the context of cancer Only protein-protein interactions imex curation imex curation jones-2007-4 A CDKN2A mutation in familial melanoma that abrogates binding of p16INK4a to CDK4 but not CDK6. human-milan_df Homo sapiens primary diploid skin fibroblasts homozygous for the R24P mutation in p16INK4A milan_df Human Milan diploid fibroblasts A culture of primary skin fibroblasts from a biopsy of a patient homozygous for the R24P mutation in p16INK4A anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jones R., Ruas M., Gregory F., Moulin S., Delia D., Manoukian S., Rowe J., Brookes S., Peters G. Apoptosis - Interactions involving proteins with a function related to apoptosis To enhance expression of p14ARF, cells were infected with a recombinant retrovirus encoding an ER-E2F1 fusion protein. Upon addition of 4-hydroxy tamoxifen to activate E2F1 expression, p14ARF became detectable by immunoblotting. gordon.peters@cancer.org.uk Cancer Res. (0008-5472) 2007 IMEx Cancer - Interactions investigated in the context of cancer Only protein-protein interactions imex curation imex curation cdn2a_human Cyclin-dependent kinase inhibitor 2A CDKN2A CDKN2 Cyclin-dependent kinase 4 inhibitor A p16-INK4a Multiple tumor suppressor 1 MTS1 protein protein human Homo sapiens Human MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD cdk6_human Cyclin-dependent kinase 6 CDK6 Serine/threonine-protein kinase PLSTIRE Cell division protein kinase 6 CDKN6 protein protein human Homo sapiens Human MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA cdk4_human Cyclin-dependent kinase 4 CDK4 Cell division protein kinase 4 PSK-J3 protein protein human Homo sapiens Human MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE arf_human Tumor suppressor ARF p14ARF CDKN2A CDKN2 MLM Alternative reading frame Cyclin-dependent kinase inhibitor 2A protein protein human Homo sapiens Human MVRRFLVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPSGGAAAAPRRGAQLRRPRHSHPTRARRCPGGLPGHAGGAAPGRGAAGRARCLGPSARGPG mdm2_human E3 ubiquitin-protein ligase Mdm2 MDM2 p53-binding protein Mdm2 Oncoprotein Mdm2 Double minute 2 protein RING-type E3 ubiquitin transferase Mdm2 protein protein human Homo sapiens Human MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQDKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP p16ink4a-cdk4-1 p16INK4A coimmunoprecipitates CDK4 and CDK6 from Hs68 lysates 671207 N/A 671212 unspecified role unspecified role bait bait N/A 671213 unspecified role unspecified role prey prey N/A 671214 unspecified role unspecified role prey prey association association false false false 2 B cdk6-cdkn2a-4 p16INK4A coimmunoprecipitates with CDK6 in Hs68 lysates 671207 N/A 671212 unspecified role unspecified role prey prey N/A 671213 unspecified role unspecified role bait bait physical association physical association false false false 2 B cdk4-cdkn2a-5 p16INK4A coimmunoprecipitates with CDK4 in Hs68 lysates 671207 N/A 671214 unspecified role unspecified role bait bait N/A 671212 unspecified role unspecified role prey prey physical association physical association false false false 2 B p16INK4A (R24P) does not coimmunoprecipitate with CDK4 in Milan HDF lysates. cdk4-cdkn2a-3 CDK4 coimmunoprecipitates endogenous p16INK4A in lysates from human diploid fibroblasts 671208 N/A 671212 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P42771:p.Ala20Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 671214 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 1 A cdk6-cdkn2a-3 CDK6 coimmunoprecipitates endogenous p16INK4A in lysates from human diploid fibroblasts 671208 N/A 671213 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 671212 unspecified role unspecified role prey prey P42771:p.Ala20Pro mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1 A cdk4-cdkn2a-4 CDK4 coimmunoprecipitates HA-p16INK4A in lysates from human diploid fibroblasts 671209 N/A 671212 unspecified role unspecified role prey prey P42771:p.Arg24Pro mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P42771:p.Ala20Pro mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 671214 unspecified role unspecified role bait bait physical association physical association false false false 1 B P42771 infection The arg24pro mutation in p16INK4A does not affect binding to CDK6, although it abrogates binding to CDK4. cdk6-cdkn2a-2 CDK6 coimmunoprecipitates HA-p16INK4A in lysates from human diploid fibroblasts 671209 N/A 671212 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P42771:p.Ala20Pro mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 671213 unspecified role unspecified role bait bait physical association physical association false false false 1 B 2HA-tagged wild-type p16INK4a coprecipitated with both CDK4 and CDK6, whereas the A20P variant did not. In line with the in vitro binding data, the R24P variant coprecipitated with CDK6 but not with CDK4. The arg24pro mutation in p16INK4A does not affect binding to CDK6, although it abrogates binding to CDK4. P42771 infection cdkn2a-cdk6-2 p16INK4A coimmunoprecipitates CDK6 from Milan human diploid fibroblast (HDF) lysates 671210 N/A 671212 unspecified role unspecified role prey prey arg24pro variant variant certain certain sequence position certain certain certain sequence position certain false N/A 671213 unspecified role unspecified role bait bait physical association physical association false false false 2 B In Milan HDF lysates p16INK4A R24P coimmunoprecipitates CDK6 but not CDK4. cdk6-cdkn2a-5 p16INK4A coimmunoprecipitates with CDK6 from Milan human diploid fibroblast (HDF) lysates 671210 N/A 671212 unspecified role unspecified role bait bait arg24pro variant variant certain certain sequence position certain certain certain sequence position certain false N/A 671213 unspecified role unspecified role prey prey physical association physical association false false false 2 B In Milan HDF lysates p16INK4A R24P coimmunoprecipitates with CDK6 but not CDK4. arf-mdm2-1 p14ARF coimmunoprecipitates MDM2 in Milan HDF lysates 671211 N/A 671215 unspecified role unspecified role bait bait N/A 671216 unspecified role unspecified role prey prey physical association physical association false false false 2 C