IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhang-2007b-2 Identification of a Novel Inhibitor of Differentiation-1 (ID-1) Binding Partner, Caveolin-1, and Its Role in Epithelial-Mesenchymal Transition and Resistance to Apoptosis in Prostate Cancer Cells. human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang X., Ling MT., Wang Q., Lau CK., Leung SC., Lee TK., Cheung AL., Wong YC., Wang X. Apoptosis - Interactions involving proteins with a function related to apoptosis PMID 12016143 with the last author as one of the authors describes the Id-1 construct as of human origin and a number of papers by Wang, X. refer back to this reference as describing the Id-1 construct. ycwong@hkucc.hku.hk A cDNA library derived from a human nonmalignant prostatic epithelial cell line, Hpr-1, was used. J. Biol. Chem. (0021-9258) 2007 Cancer - Interactions investigated in the context of cancer zhang-2007b-1 Identification of a Novel Inhibitor of Differentiation-1 (ID-1) Binding Partner, Caveolin-1, and Its Role in Epithelial-Mesenchymal Transition and Resistance to Apoptosis in Prostate Cancer Cells. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zhang X., Ling MT., Wang Q., Lau CK., Leung SC., Lee TK., Cheung AL., Wong YC., Wang X. Apoptosis - Interactions involving proteins with a function related to apoptosis PMID 12016143 with the last author as one of the authors describes the Id-1 construct as of human origin and a number of papers by Wang, X. refer back to this reference as describing the Id-1 construct. ycwong@hkucc.hku.hk A cDNA library derived from a human nonmalignant prostatic epithelial cell line, Hpr-1, was used. J. Biol. Chem. (0021-9258) 2007 Cancer - Interactions investigated in the context of cancer zhang-2007b-3 Identification of a Novel Inhibitor of Differentiation-1 (ID-1) Binding Partner, Caveolin-1, and Its Role in Epithelial-Mesenchymal Transition and Resistance to Apoptosis in Prostate Cancer Cells. human-du_145 Homo sapiens DU-145 prostate cancer cell line du_145 DU-145 Human prostate carcinoma established from the tumor tissue removed from the metastatic central nervous system lesion of a 69-year-old man with prostate carcinoma in 1975 confirmed as human with IEF of AST, MDH, NP Human prostate carcinoma established from the tumor tissue removed from the metastatic central nervous system lesion of a 69-year-old man with prostate carcinoma in 1975 confirmed as human with IEF of AST, MDH, NP anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang X., Ling MT., Wang Q., Lau CK., Leung SC., Lee TK., Cheung AL., Wong YC., Wang X. Apoptosis - Interactions involving proteins with a function related to apoptosis PMID 12016143 with the last author as one of the authors describes the Id-1 construct as of human origin and a number of papers by Wang, X. refer back to this reference as describing the Id-1 construct. ycwong@hkucc.hku.hk A cDNA library derived from a human nonmalignant prostatic epithelial cell line, Hpr-1, was used. J. Biol. Chem. (0021-9258) 2007 Cancer - Interactions investigated in the context of cancer zhang-2007b-4 Identification of a Novel Inhibitor of Differentiation-1 (ID-1) Binding Partner, Caveolin-1, and Its Role in Epithelial-Mesenchymal Transition and Resistance to Apoptosis in Prostate Cancer Cells. human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang X., Ling MT., Wang Q., Lau CK., Leung SC., Lee TK., Cheung AL., Wong YC., Wang X. Apoptosis - Interactions involving proteins with a function related to apoptosis PMID 12016143 with the last author as one of the authors describes the Id-1 construct as of human origin and a number of papers by Wang, X. refer back to this reference as describing the Id-1 construct. ycwong@hkucc.hku.hk A cDNA library derived from a human nonmalignant prostatic epithelial cell line, Hpr-1, was used. J. Biol. Chem. (0021-9258) 2007 Cancer - Interactions investigated in the context of cancer zhang-2007b-5 Identification of a Novel Inhibitor of Differentiation-1 (ID-1) Binding Partner, Caveolin-1, and Its Role in Epithelial-Mesenchymal Transition and Resistance to Apoptosis in Prostate Cancer Cells. human-hpr_1 Homo sapiens normal prostate epithelial cell line hpr_1 Human normal prostate epithelial cell line fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Zhang X., Ling MT., Wang Q., Lau CK., Leung SC., Lee TK., Cheung AL., Wong YC., Wang X. Apoptosis - Interactions involving proteins with a function related to apoptosis PMID 12016143 with the last author as one of the authors describes the Id-1 construct as of human origin and a number of papers by Wang, X. refer back to this reference as describing the Id-1 construct. ycwong@hkucc.hku.hk A cDNA library derived from a human nonmalignant prostatic epithelial cell line, Hpr-1, was used. J. Biol. Chem. (0021-9258) 2007 Cancer - Interactions investigated in the context of cancer id1_human DNA-binding protein inhibitor ID-1 ID1 ID Inhibitor of DNA binding 1 BHLHB24 Class B basic helix-loop-helix protein 24 Inhibitor of differentiation 1 protein protein human Homo sapiens Human MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI id1-cav1-1 Id-1-FLAG coimmunoprecipitates Cav-1-HA from LNCaP lysates 680348 N/A 680353 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P41134:p.Tyr101Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 680354 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1 A, E P41134; Q03135 transfection PREY gene NM_001753 The deletion analysis and mutational analysis suggest that the HLH domain (aa 66-106) of Id-1 is essential for its interaction with Cav-1. cav1-id1 Id-1-FLAG coimmunoprecipitates with Cav-1-HA from LNCaP lysates 680348 N/A 680353 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 680354 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1 A Q03135; P41134 transfection BAIT gene NM_001753 id1-cav1 Id-1 and Cav-1 interact in a yeast two-hybrid assay 680349 N/A 680354 unspecified role unspecified role prey prey N/A 680353 unspecified role unspecified role bait bait physical association physical association false false false PREY gene NM_001753 cav1-id1-1 Endogenous Cav-1 coimmunoprecipitates endogenous Id-1 in DU145 lysates 680350 N/A 680354 unspecified role unspecified role bait bait N/A 680353 unspecified role unspecified role prey prey physical association physical association false false false 1 B cav1-id1-2 Endogenous Cav-1 coimmunoprecipitates endogenous Id-1 in PC3 lysates 680351 N/A 680353 unspecified role unspecified role prey prey N/A 680354 unspecified role unspecified role bait bait physical association physical association false false false 1 B cav1-id1-3 Cav-1 and Id-1 colocalize in the cytoplasm of Hpr1- cells 680352 N/A 680354 unspecified role unspecified role neutral component neutral component N/A 680353 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 1 C