IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lubyova-2007-7 Stimulation of c-Myc transcriptional activity by vIRF-3 of Kaposi sarcoma-associated herpesvirus. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lubyova B., Kellum MJ., Frisancho JA., Pitha PM. Cancer - Interactions investigated in the context of cancer bluby@lf1.cuni.cz J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation A human leukocyte cDNA library was used. lubyova-2007-2 Stimulation of c-Myc transcriptional activity by vIRF-3 of Kaposi sarcoma-associated herpesvirus. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lubyova B., Kellum MJ., Frisancho JA., Pitha PM. Cancer - Interactions investigated in the context of cancer bluby@lf1.cuni.cz J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation A human leukocyte cDNA library was used. lubyova-2007-1 Stimulation of c-Myc transcriptional activity by vIRF-3 of Kaposi sarcoma-associated herpesvirus. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lubyova B., Kellum MJ., Frisancho JA., Pitha PM. Cancer - Interactions investigated in the context of cancer bluby@lf1.cuni.cz A human leukocyte cDNA library was used. J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation lubyova-2007-3 Stimulation of c-Myc transcriptional activity by vIRF-3 of Kaposi sarcoma-associated herpesvirus. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lubyova B., Kellum MJ., Frisancho JA., Pitha PM. Cancer - Interactions investigated in the context of cancer bluby@lf1.cuni.cz J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation A human leukocyte cDNA library was used. lubyova-2007-4 Stimulation of c-Myc transcriptional activity by vIRF-3 of Kaposi sarcoma-associated herpesvirus. human-bcbl_1 Homo sapiens lymphoma cell line bcbl_1 Human BCBL-1 KSHV/HHV8-Infected body-cavity-based lymphoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lubyova B., Kellum MJ., Frisancho JA., Pitha PM. Cancer - Interactions investigated in the context of cancer bluby@lf1.cuni.cz J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation A human leukocyte cDNA library was used. lubyova-2007-5 Stimulation of c-Myc transcriptional activity by vIRF-3 of Kaposi sarcoma-associated herpesvirus. human-bc_3 Homo sapiens BC-3 lymphoma cell line bc_3 Human BC-3 primary effusion lymphoma cell line BC-3 is a primary effusion lymphoma cell line. The cells were established from pleural effusion from a human immunodeficiency virus (HIV) negative patient diagnosed with primary effusion (body cavity based) lymphoma (PEL). The BC-3 cell line contains the viral genome for Kaposi's sarcoma-associated herpesvirus (KSHV, provisionally designated HHV-8). The BC-3 cell line allows in vitro culture of KSHV viral genomes in the absence of EBV. It is ideal for the isolation and study of KSHV. BC-3 has an intact KSHV genome of about 170 kb both in the cell line and in the viral isolate. (Source of information: ATCC) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lubyova B., Kellum MJ., Frisancho JA., Pitha PM. Cancer - Interactions investigated in the context of cancer bluby@lf1.cuni.cz J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation A human leukocyte cDNA library was used. lubyova-2007-6 Stimulation of c-Myc transcriptional activity by vIRF-3 of Kaposi sarcoma-associated herpesvirus. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lubyova B., Kellum MJ., Frisancho JA., Pitha PM. Cancer - Interactions investigated in the context of cancer bluby@lf1.cuni.cz J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation A human leukocyte cDNA library was used. lubyova-2007-8 Stimulation of c-Myc transcriptional activity by vIRF-3 of Kaposi sarcoma-associated herpesvirus. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lubyova B., Kellum MJ., Frisancho JA., Pitha PM. Cancer - Interactions investigated in the context of cancer bluby@lf1.cuni.cz J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation A human leukocyte cDNA library was used. cdk4_human_dna Double-stranded oligomer corresponding to MBS4 in human cdk4 promoter ds dna double stranded deoxyribonucleic acid ds DNA ds dna human Homo sapiens Human CCCTCAGCGCATGGGTGGCGGTCACGTGCCCAGAACGTCCGG q9dun1_hhv8 vIRF-3 VIRF-3 protein protein hhv8 Human herpesvirus 8 (HHV-8) Kaposi's sarcoma-associated herpesvirus HHV-8 MAGRRLTWISEFIVGALDSDKYPLVKWLDRSTGTFLAPAARNDVIPLDSLQFFIDFKRECLSKGLHPRDLLGSPITAFGKICTTSRRLRRLPGEEYEVVQGINCRRWRLLCAEVKECWWCVHARTHLHSGSSLWEILYQHSVRLEKHRRRPRPFVGENSDSSEEDHPAFCDVPVTQTGAESEDSGDEGPSTRHSASGVQPVDDANADSPGSGDEGPSTRHSDSQPPPADETTVHTDNVEDDLTLLDKESACALMYHVGQEMDMLMRAMCDEDLFDLLGIPEDVIATSQPGGDTDASGVVTEGSIAASAVGAGVEDVYLAGALEAQNVAGEYVLEISDEEVDDGAGLPPASRRRPVVGEFLWDDGPRRHERPTTRRIRHRKLRSAYYRVARPPVMITDRLGVEVFYFGRPAMSLEVERKVFILCSQNPLADISHSCLHSRKGLRVLLPKPDDNNTGPGDVNLLAAVLRSFASGLVIVSLRSGIYVKNLCKSTVLYHGNNPPKKFGVICGLSSRAVLDVFNVAQYRIQGHEHIKKTTVFIGGDPTSAEQFDMVPLVIKLRLRSVTCDD myc_human Myc proto-oncogene protein BHLHE39 Transcription factor p64 MYC Proto-oncogene c-Myc Class E basic helix-loop-helix protein 39 protein protein human Homo sapiens Human MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA 4xebox_dna Tetramerized E-box sequence ds dna double stranded deoxyribonucleic acid ds DNA ds dna human Homo sapiens Human CCCTCAGCGCATGGGTGGCGGTCACGTGCACGTGCACGTGCACGTGCCCAGAACG pfd5_human Prefoldin subunit 5 c-Myc-binding protein Mm-1 PFDN5 MM1 Myc modulator 1 PFD5 protein protein human Homo sapiens Human MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA cdk4_dna-virf_3 vIRF-3 associated with an oligomer corresponding to the MBS4 of the human cdk4 promoter 729500 N/A 729508 unspecified role unspecified role bait bait N/A 729509 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false 6 A MM-1alpha - The binding of vIRF-3 to the cdk4 promoter decreased in the presence of MM-1alpha. cdk4_dna-myc-1 c-Myc and vIRF-3 bind to oligomers corresponding to the MBS4 in the human cdk4 promoter 729500 N/A 729510 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 729509 unspecified role unspecified role prey prey N/A 729508 unspecified role unspecified role bait bait association association false false false 6 B cdk4_dna-myc-2 c-Myc and vIRF-3 bind to oligomers corresponding to the tetramerized E-box sequence (4XE-box) 729500 N/A 729511 unspecified role unspecified role bait bait N/A 729509 unspecified role unspecified role prey prey N/A 729510 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. association association false false false 6 B cdk4_dna-virf_3-1 vIRF-3 associated with an oligomer corresponding to the MBS4 of the human cdk4 promoter 729500 N/A 729508 unspecified role unspecified role bait bait N/A 729509 unspecified role unspecified role prey prey rat-tgr_1 Rattus norvegicus fibroblast cell line tgr_1 Rat fibroblast cell line These cells express endogenous c-Myc protein. Express endogenous c-Myc protein. physical association physical association false false false 6 C c-Myc - The presence of c-Myc enhances this interaction. This interaction was much weaker in HO15 cells, c-myc null cells derived from TGR-1 cell line. pfdn5-virf_3-1 PFDN5 (MM-1) pulls down vIRF-3 in vitro 729500 N/A 729509 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 729512 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction false false false The authors used the alpha isoform of PFDN5 (MM-1alpha). This isoform is not yet available in the UniProtKB entry for the protein. 1 B virf_3-pfdn5-1 vIRF-3 pulls down PFDN5 (MM-1) in vitro 729501 n/a 729512 unspecified role unspecified role prey prey region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 729509 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false The authors used the alpha isoform of PFDN5 (MM-1alpha). This isoform is not yet available in the UNiProtKB entry for the protein. 1 B pfdn5-virf_3 PFDN5 (MM-1) pulls down vIRF-3 in vitro 729501 n/a 729512 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 729509 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction false false false The authors used the alpha isoform of PFDN5 (MM-1alpha). This isoform is not yet available in the UNiProtKB entry for the protein. 2 C, D cdk4_dna-myc c-Myc binds to oligomers corresponding to the MBS4 in the human cdk4 promoter 729501 N/A 729508 unspecified role unspecified role bait bait N/A 729510 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false 6 A virf_3-pfdn5 vIRF-3 and PFDN5 (MM-1) interact in a yeast two-hybrid assay 729502 N/A 729509 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 729512 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind range range range range false physical association physical association false false false The ranges given by the authors for MM-1 and MM-1alpha are 17-167 and 4-167,respectively. However, the UniProtKB entry for this protein (Q99471) is only 154 aa in length. The alpha isoform is available in UniProtKB. pfdn5-myc PFDN5 (MM-1) coimmunoprecipitates c-Myc in HEK293 lysates 729503 N/A 729510 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 729512 unspecified role unspecified role bait bait region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 729509 inhibitor inhibitor prey prey association association false false false The authors used the alpha isoform of PFDN5 (MM-1alpha). This isoform is not yet available in the UNiProtKB entry for the protein. Q99471; Q9DUN1; P01106 transfection 5 vIRF-3 - vIRF-3 competes with MM-1alpha for binding to c-Myc virf_3-pfdn5-3 PFDN5 (MM-1) coimmunoprecipitates with vIRF-3 in BCBL-1 lysates 729504 n/a 729512 unspecified role unspecified role prey prey in vitro In vitro N/A 729509 unspecified role unspecified role bait bait physical association physical association false false false The authors used antibodies to the alpha isoform of PFDN5 (MM-1alpha). This isoform is not yet available in the UNiProtKB entry for the protein. 1 D virf_3-pfdn5-4 PFDN5 (MM-1) coimmunoprecipitates with vIRF-3 in BC-3 lysates 729505 N/A 729509 unspecified role unspecified role bait bait n/a 729512 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false The authors used antibodies to the alpha isoform of PFDN5 (MM-1alpha). This isoform is not yet available in the UNiProtKB entry for the protein. 1 D virf_3-pfdn5-2 PFDN5 (MM-1) coimmunoprecipitates vIRF-3 in HEK293 lysates 729506 N/A 729509 unspecified role unspecified role prey prey n/a 729512 unspecified role unspecified role bait bait region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false The authors used the alpha isoform of PFDN5 (MM-1alpha). This isoform is not yet available in the UNiProtKB entry for the protein. 1 C Q99471; Q9DUN1 transfection myc-virf_3 vIRF-3 ncoimmunoprecipitates with endogenous c-Myc in HEK293 lysates 729507 N/A 729509 unspecified role unspecified role prey prey N/A 729510 unspecified role unspecified role bait bait physical association physical association false false false Q9DUN1 transfection 6 D