IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mcgilvray-2007-1 UXT interacts with the transcriptional repressor protein EVI1 and suppresses cell transformation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined McGilvray R., Walker M., Bartholomew C. Apoptosis - Interactions involving proteins with a function related to apoptosis The range for the Rp domain of Evi-1 is stated in Palmer et al. (2001) J Biol Chem 276, 25830-25840. bartholomew@gcal.ac.uk FEBS J. (1742-464X) 2007 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer mcgilvray-2007-3 UXT interacts with the transcriptional repressor protein EVI1 and suppresses cell transformation. in vitro In vitro pull down pull down predetermined predetermined participant predetermined McGilvray R., Walker M., Bartholomew C. Apoptosis - Interactions involving proteins with a function related to apoptosis The range for the Rp domain of Evi-1 is stated in Palmer et al. (2001) J Biol Chem 276, 25830-25840. bartholomew@gcal.ac.uk FEBS J. (1742-464X) 2007 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer mcgilvray-2007-2 UXT interacts with the transcriptional repressor protein EVI1 and suppresses cell transformation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence McGilvray R., Walker M., Bartholomew C. Apoptosis - Interactions involving proteins with a function related to apoptosis bartholomew@gcal.ac.uk A human adult kidney cDNA library (Clontech) was used. FEBS J. (1742-464X) 2007 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer The range for the Rp domain of Evi-1 is stated in Palmer et al. (2001) J Biol Chem 276, 25830-25840. mcgilvray-2007-4 UXT interacts with the transcriptional repressor protein EVI1 and suppresses cell transformation. human-bosc_23 Homo sapiens embryonic kidney cell line BOSC-23 bosc_23 Human embryonic kidney cell line BOSC-23 The BOSC-23 cell line are a derivative of the 293T cell line. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot McGilvray R., Walker M., Bartholomew C. Apoptosis - Interactions involving proteins with a function related to apoptosis bartholomew@gcal.ac.uk FEBS J. (1742-464X) 2007 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer The range for the Rp domain of Evi-1 is stated in Palmer et al. (2001) J Biol Chem 276, 25830-25840. ctbp2_mouse C-terminal-binding protein 2 Ctbp2 protein protein mouse Mus musculus Mouse MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTVCHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPPAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNEQ mecom_human Histone-lysine N-methyltransferase MECOM MECOM EVI1 Ecotropic virus integration site 1 protein homolog MDS1 Myelodysplasia syndrome 1 protein Myelodysplasia syndrome-associated protein 1 MDS1 and EVI1 complex locus protein PRDM3 protein protein human Homo sapiens Human MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPATSSEAFTPKEGSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEILDEFYNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEDFQQKLESENDLQEIHTIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGLTFPTAPGFSFSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSKHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDIESDKEKFKENGKMFKDKVSPLQNLASINNKKEYSNHSIFSPSLEEQTAVSGAVNDSIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQSPGEVKKLQKGSSESPFDLTTKRKDEKPLTPVPSKPPVTPATSQDQPLDLSMGSRSRASGTKLTEPRKNHVFGGKKGSNVESRPASDGSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLFHPQMSAIENMAEKLESFSALKPEASELLQSVPSMFNFRAPPNALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKEDAYFTEIRNFIGNSNHGSQSPRNVEERMNGSHFKDEKALVTSQNSDLLDDEEVEDEVLLDEEDEDNDITGKTGKEPVTSNLHEGNPEDDYEETSALEMSCKTSPVRYKEEEYKSGLSALDHIRHFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMMLSLSDKESLHSTSHSSSNVWHSMARAAAESSAIQSISHV uxt_human Protein UXT UXT HSPC024 Ubiquitously expressed transcript protein Androgen receptor trapped clone 27 protein protein protein human Homo sapiens Human MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH evi1-ctbp2-1 Evi1 interacts with mCtBP2 in a yeast two-hybrid assay 661905 N/A 661909 unspecified role unspecified role prey prey N/A 661910 unspecified role unspecified role bait bait region Rp domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1 A, B, C, 5 D, E, F The Rp-deletion mutant lacking aa 706-707 retains ability to bind mCtBP2. evi1-uxt-1 Evi1 interacts with UXT in a yeast two-hybrid assay 661905 N/A 661911 cofactor cofactor coenzyme bait bait N/A 661910 cofactor cofactor coenzyme prey prey region Rp domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1 A, B, C, 5 D, E, F uxt-uxt UXT homodimerizes in a yeast two-hybrid assay 661905 N/A 661911 unspecified role unspecified role bait bait N/A 661911 unspecified role unspecified role prey prey physical association physical association false false false 1 A, B, C uxt-evi1 GST-UXT pulls down Evi-1 in vitro 661906 N/A 661911 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 661910 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false 3 B evi1-uxt-2 GST-Evi-1 pulls down UXT in vitro 661906 N/A 661910 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 661911 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false 3 B evi1-uxt Evi1 interacts with UXT in a yeast two-hybrid assay 661907 N/A 661910 unspecified role unspecified role bait bait region Rp domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 661911 unspecified role unspecified role prey prey physical association physical association false false false evi1-uxt-3 Evi-1-myc coimmunoprecipitates HA-UXT in BOSC-23 lysates 661908 N/A 661910 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 661911 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3 C Q03112; Q9UBK9 transfection.