IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ li-2007-1 A yeast two-hybrid system using Sp17 identified Ropporin as a novel cancer-testis antigen in hematologic malignancies. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Li Z., Li W., Meklat F., Wang Z., Zhang J., Zhang Y., Lim SH. Cancer - Interactions investigated in the context of cancer The authors confirmed by email that the SP17 construct used was of human origin and that the form of ropporin was ropporin-1. seah.lim@usoncology.com A human testis cDNA library was used. Int. J. Cancer (0020-7136) 2007 Only protein-protein interactions imex curation rop1a_human Ropporin-1A ROPN1A Rhophilin-associated protein 1A Cancer/testis antigen 91 ROPN1 protein protein human Homo sapiens Human MAQTDKPTCIPPELPKMLKEFAKAAIRVQPQDLIQWAADYFEALSRGETPPVRERSERVALCNRAELTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGSPRIPFSTFQFLYTYIAKVDGEISASHVSRMLNYMEQEVIGPDGIITVNDFTQNPRVQLE sp17_human Sperm surface protein Sp17 SPA17 SP17 Sperm autoantigenic protein 17 Sp17-1 Cancer/testis antigen 22 protein protein human Homo sapiens Human MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEENK spa17-ropn1 Sp17 interacted with Ropporin in a yeast two-hybrid assay 657373 N/A 657374 unspecified role unspecified role prey prey N/A 657375 unspecified role unspecified role bait bait physical association physical association false false false