IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ jiang-2007a-3 FB1, an E2A fusion partner in childhood leukemia, interacts with U19/EAF2 and inhibits its transcriptional activity. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jiang F., Ai J., Xiao W., Wang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis The N-terminal construct of EAF2 is up to and including exon III which is specified in the paper as coding for aa 68 - 114. wangz2@upmc.edu A cDNA library generated from whole prostate glands pooled from 10 Caucasians, ages 14-60 (Clontech #HL4511AK) fused to the activation domain of the E. coli transcription factor B42 was used. Cancer Lett. (0304-3835) 2007 Cancer - Interactions investigated in the context of cancer jiang-2007a-1 FB1, an E2A fusion partner in childhood leukemia, interacts with U19/EAF2 and inhibits its transcriptional activity. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Jiang F., Ai J., Xiao W., Wang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis wangz2@upmc.edu A cDNA library generated from whole prostate glands pooled from 10 Caucasians, ages 14-60 (Clontech #HL4511AK) fused to the activation domain of the E. coli transcription factor B42 was used. Cancer Lett. (0304-3835) 2007 Cancer - Interactions investigated in the context of cancer jiang-2007a-2 FB1, an E2A fusion partner in childhood leukemia, interacts with U19/EAF2 and inhibits its transcriptional activity. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Jiang F., Ai J., Xiao W., Wang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis wangz2@upmc.edu A cDNA library generated from whole prostate glands pooled from 10 Caucasians, ages 14-60 (Clontech #HL4511AK) fused to the activation domain of the E. coli transcription factor B42 was used. Cancer Lett. (0304-3835) 2007 Cancer - Interactions investigated in the context of cancer jiang-2007a-4 FB1, an E2A fusion partner in childhood leukemia, interacts with U19/EAF2 and inhibits its transcriptional activity. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Jiang F., Ai J., Xiao W., Wang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis wangz2@upmc.edu A cDNA library generated from whole prostate glands pooled from 10 Caucasians, ages 14-60 (Clontech #HL4511AK) fused to the activation domain of the E. coli transcription factor B42 was used. Cancer Lett. (0304-3835) 2007 Cancer - Interactions investigated in the context of cancer eaf2_human ELL-associated factor 2 EAF2 TRAITS BM-040 Testosterone-regulated apoptosis inducer and tumor suppressor protein protein protein human Homo sapiens Human MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNLVKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRDNSGLLMNTLRNDLQLSESGSDSDD tfpt_human TCF3 fusion partner TFPT Protein FB1 INO80F INO80 complex subunit F protein protein human Homo sapiens Human MELEQREGTMAAVGFEEFSAPPGSELALPPLFGGHILESELETEVEFVSGGLGGSGLRERDEEEEAARGRRRRQRELNRRKYQALGRRCREIEQVNERVLNRLHQVQRITRRLQQERRFLMRVLDSYGDDYRASQFTIVLEDEGSQGTDAPTPGNAENEPPEKETLSPPRRTPAPPEPGSPAPGEGPSGRKRRRVPRDGRRAGNALTPELAPVQIKVEEDFGFEADEALDSSWVSRGPDKLLPYPTLASPASD eaf1_human ELL-associated factor 1 EAF1 protein protein human Homo sapiens Human MNGTANPLLDREEHCLRLGESFEKRPRASFHTIRYDFKPASIDTSCEGELQVGKGDEVTITLPHIPGSTPPMTVFKGNKRPYQKDCVLIINHDTGEYVLEKLSSSIQVKKTRAEGSSKIQARMEQQPTRPPQTSQPPPPPPPMPFRAPTKPPVGPKTSPLKDNPSPEPQLDDIKRELRAEVDIIEQMSSSSGSSSSDSESSSGSDDDSSSSGGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSNQLMNTLRNDLQLSESGSDSDD ell_human RNA polymerase II elongation factor ELL ELL C19orf17 Eleven-nineteen lysine-rich leukemia protein protein protein human Homo sapiens Human MAALKEDRSYGLSCGRVSDGSKVSVFHVKLTDSALRAFESYRARQDSVSLRPSIRFQGSQGHISIPQPDCPAEARTFSFYLSNIGRDNPQGSFDCIQQYVSSHGEVHLDCLGSIQDKITVCATDDSYQKARQSMAQAEEETRSRSAIVIKAGGRYLGKKVQFRKPAPGATDAVPSRKRATPINLASAIRKSGASAVSGGSGVSQRPFRDRVLHLLALRPYRKAELLLRLQKDGLTQADKDALDGLLQQVANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLCQPQSTGSLLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQPAVNGKLGVPNGREALLPTPGPPASTDTLSSSTHLPPRLEPPRAHDPLADVSNDLGHSGRDCEHGEAAAPAPTVRLGLPLLTDCAQPSRPHGSPSRSKPKKKSKKHKDKERAAEDKPRAQLPDCAPATHATPGAPADTPGLNGTCSVSSVPTSTSETPDYLLKYAAISSSEQRQSYKNDFNAEYSEYRDLHARIERITRRFTQLDAQLRQLSQGSEEYETTRGQILQEYRKIKKTNTNYSQEKHRCEYLHSKLAHIKRLIAEYDQRQLQAWP tfpt-eaf2 Myc-FB1 coimmunoprecipitates GFP-EAF2 in COS-7 cell lysates 605667 N/A 605671 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 605672 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1 A, 2 Q96CJ1; P0C1Z6 transfection tfpt-eaf2-1 Myc-FB1 coimmunoprecipitates with FLAG-EAF2 in COS-7 cell lysates 605667 N/A 605671 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 605672 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1 B Q96CJ1; P0C1Z6 transfection tfpt-eaf1 Myc-FB1 coimmunoprecipitates with GFP-EAF1 in COS-7 cell lysates 605667 N/A 605673 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 605672 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3 Q96JC9; P0C1Z6 transfection tfpt-ell FLAG-FB1 coimmunoprecipitates with Myc-ELL in COS-7 cell lysates 605667 N/A 605674 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 605672 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5 A P55199; P0C1Z6 transfection eaf2-tfpt U19/EAF2 interacts with FB1 in a yeast two-hybrid assay 605668 N/A 605672 unspecified role unspecified role prey prey N/A 605671 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false eaf2-tfpt-1 U19/EAF2 interacts with FB1 in a yeast two-hybrid assay 605669 N/A 605671 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 605672 unspecified role unspecified role prey prey physical association physical association false false false tfpt-ell-1 GFP-FB1 colocalizes with RFP-ELL in COS-7 cells 605670 N/A 605672 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 605674 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5 B P55199; P0C1Z6 transfection