IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ chen-2007-2 Mammalian tumor suppressor Int6 specifically targets hypoxia inducible factor 2 alpha for degradation by hypoxia- and pVHL-independent regulation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chen L., Uchida K., Endler A., Shibasaki F. Cancer - Interactions investigated in the context of cancer fshibasa@rinshoken.or.jp A pretransformed human heart MATCHMAKER cDNA library (Clonetech) was used. J. Biol. Chem. (0021-9258) 2007 chen-2007-8 Mammalian tumor suppressor Int6 specifically targets hypoxia inducible factor 2 alpha for degradation by hypoxia- and pVHL-independent regulation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chen L., Uchida K., Endler A., Shibasaki F. Cancer - Interactions investigated in the context of cancer The authors assigned confidence based on beta-galactosidase activity, the highest confidence given was (+++) and the lowest (-). fshibasa@rinshoken.or.jp A pretransformed human heart MATCHMAKER cDNA library (Clonetech) was used. J. Biol. Chem. (0021-9258) 2007 chen-2007-1 Mammalian tumor suppressor Int6 specifically targets hypoxia inducible factor 2 alpha for degradation by hypoxia- and pVHL-independent regulation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Chen L., Uchida K., Endler A., Shibasaki F. Cancer - Interactions investigated in the context of cancer fshibasa@rinshoken.or.jp A pretransformed human heart MATCHMAKER cDNA library (Clonetech) was used. J. Biol. Chem. (0021-9258) 2007 chen-2007-3 Mammalian tumor suppressor Int6 specifically targets hypoxia inducible factor 2 alpha for degradation by hypoxia- and pVHL-independent regulation. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Chen L., Uchida K., Endler A., Shibasaki F. Cancer - Interactions investigated in the context of cancer fshibasa@rinshoken.or.jp A pretransformed human heart MATCHMAKER cDNA library (Clonetech) was used. J. Biol. Chem. (0021-9258) 2007 chen-2007-4 Mammalian tumor suppressor Int6 specifically targets hypoxia inducible factor 2 alpha for degradation by hypoxia- and pVHL-independent regulation. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen L., Uchida K., Endler A., Shibasaki F. Cancer - Interactions investigated in the context of cancer fshibasa@rinshoken.or.jp A pretransformed human heart MATCHMAKER cDNA library (Clonetech) was used. J. Biol. Chem. (0021-9258) 2007 chen-2007-5 Mammalian tumor suppressor Int6 specifically targets hypoxia inducible factor 2 alpha for degradation by hypoxia- and pVHL-independent regulation. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen L., Uchida K., Endler A., Shibasaki F. Cancer - Interactions investigated in the context of cancer fshibasa@rinshoken.or.jp A pretransformed human heart MATCHMAKER cDNA library (Clonetech) was used. J. Biol. Chem. (0021-9258) 2007 chen-2007-6 Mammalian tumor suppressor Int6 specifically targets hypoxia inducible factor 2 alpha for degradation by hypoxia- and pVHL-independent regulation. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen L., Uchida K., Endler A., Shibasaki F. Cancer - Interactions investigated in the context of cancer fshibasa@rinshoken.or.jp A pretransformed human heart MATCHMAKER cDNA library (Clonetech) was used. J. Biol. Chem. (0021-9258) 2007 chen-2007-7 Mammalian tumor suppressor Int6 specifically targets hypoxia inducible factor 2 alpha for degradation by hypoxia- and pVHL-independent regulation. human-786_o Homo sapiens renal cell adenocarcinoma 786_o Human renal cell adenocarcinoma cell line CRL-1932 is the ATCC identifier. ATCC identifier is CRL-1932. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen L., Uchida K., Endler A., Shibasaki F. Cancer - Interactions investigated in the context of cancer fshibasa@rinshoken.or.jp A pretransformed human heart MATCHMAKER cDNA library (Clonetech) was used. J. Biol. Chem. (0021-9258) 2007 epas1_human Endothelial PAS domain-containing protein 1 EPAS1 HIF2A MOP2 Member of PAS protein 2 Basic-helix-loop-helix-PAS protein MOP2 BHLHE73 PASD2 Hypoxia-inducible factor 2-alpha HIF-1-alpha-like factor PAS domain-containing protein 2 Class E basic helix-loop-helix protein 73 protein protein human Homo sapiens Human MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGLTQVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRGRTVNLKSATWKVLHCTGQVKVYNNCPPHNSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLDSKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFGNQNFEESSAYGKAILPPSQPWATELRSHSTQSEAGSLPAFTVPQAAAPGSTTPSATSSSSSCSTPNSPEDYYTSLDNDLKIEVIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHLPLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELTRYDCEVNVPVLGSSTLLQGGDLLRALDQAT eif3e_human Eukaryotic translation initiation factor 3 subunit E EIF3E INT6 EIF3S6 Eukaryotic translation initiation factor 3 subunit 6 eIF-3 p48 Viral integration site protein INT-6 homolog protein protein human Homo sapiens Human MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY epas1-eif3s6-1 HIF-2 alpha interacts with Int6/eIF3e/p48 in a yeast two-hybrid assay 605048 N/A 605056 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 605057 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false PREY gene U94175 1 C The approx. beta-galactosidase activity for HIF-2alpha constructs: (571-700) 15, (571-828) 8, (641-828) 7, (701-828) 0. eif3s6-epas1-6 HIF-2 alpha interacts with Int6/eIF3e/p48 in a yeast two-hybrid assay 605048 N/A 605056 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 605057 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false PREY gene U94175 1 D The approx. beta-galactosidase activity for Int6 constructs: (4-128) 17, (wt) 6, (129-455) 2, (129-260) 2. epas1-eif3s6-3 HIF-2 alpha interacts with Int6/eIF3e/p48 in a beta-galactosidase assay 605049 N/A 605057 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 605056 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (highest score given) PREY gene U94175 The region aa 571-828 of HIF-2 alpha is the region of greatest sequence divergence between the HIF-alpha proteins. 1 B Int6 interacted with HIF-2alpha, but not to HIF-1alpha nor HIF-3alpha. +++ (highest score given) epas1-eif3s6-4 HIF-2 alpha interacts with Int6/eIF3e/p48 in a beta-galactosidase assay 605049 N/A 605057 unspecified role unspecified role prey prey N/A 605056 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (highest score given) PREY gene U94175 The region aa 571-828 of HIF-2 alpha is the region of greatest sequence divergence between the HIF-alpha proteins. 1 B Int6 did not interact with HIF-1alpha nor HIF-3alpha. +++ (highest score given) epas1-eif3s6 HIF-2 alpha interacts with Int6/eIF3e/p48 in a yeast two-hybrid assay 605050 N/A 605057 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 605056 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false PREY gene U94175 The region aa 571-828 of HIF-2 alpha is the region of greatest sequence divergence between the HIF-alpha proteins. epas1-eif3s6-2 HIF-2 alpha colocalizes with Int6/eIF3e/p48 in the nucleus of MCF-7 cells under normoxia 605051 N/A 605057 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 605056 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 2 A The author identifier for P60228 is U94175. Q99814; P60228 transfection When Myc-HIF-2 alpha was coexpressed, HA-Int6 localization changed from cytoplasmic to nuclear. eif3s6-epas1-2 Myc-HIF-2 alpha coimmunoprecipitates with HA-Int6/eIF3e/p48 in HeLa cells 605052 N/A 605057 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 605056 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2 B BAIT gene U94175. Q99814; P60228 transfection This interaction occurs under normoxia. eif3s6-epas1-1 Endogenous HIF-2 alpha coimmunoprecipitates with endogenous Int6/eIF3e/p48 in HeLa cells 605053 N/A 605057 unspecified role unspecified role bait bait N/A 605056 unspecified role unspecified role prey prey physical association physical association false false false 2 C BAIT gene U94175. The interaction occurs under normoxia. eif3s6-epas1-3 Endogenous HIF-2 alpha coimmunoprecipitates with endogenous Int6/eIF3e/p48 in MCF-7 cells 605054 N/A 605056 unspecified role unspecified role prey prey N/A 605057 unspecified role unspecified role bait bait physical association physical association false false false 2 C BAIT gene U94175. The interaction occurs under normoxia. eif3s6-epas1-4 Endogenous HIF-2 alpha coimmunoprecipitates with endogenous Int6/eIF3e/p48 in 786-O cells 605055 N/A 605057 unspecified role unspecified role bait bait N/A 605056 unspecified role unspecified role prey prey physical association physical association false false false 2 C BAIT gene U94175. The interaction occurs under normoxia.