IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ buchsbaum-2007-2 Human INT6 interacts with MCM7 and regulates its stability during S phase of the cell cycle. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Buchsbaum S., Morris C., Bochard V., Jalinot P. Cancer - Interactions investigated in the context of cancer A unique UniProtKB entry could not be associated with the p110 subunit of eIF3 or RFP since the exact gene product of the interactor cannot be ascertained. pjalinot@ens-lyon.fr A library of cDNAs prepared from human lymphocytes immortalized with EBV was used. Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation buchsbaum-2007-4 Human INT6 interacts with MCM7 and regulates its stability during S phase of the cell cycle. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Buchsbaum S., Morris C., Bochard V., Jalinot P. Cancer - Interactions investigated in the context of cancer A unique UniProtKB entry could not be associated with the p110 subunit of eIF3 or RFP since the exact gene product of the interactor cannot be ascertained. pjalinot@ens-lyon.fr A library of cDNAs prepared from human lymphocytes immortalized with EBV was used. Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation buchsbaum-2007-5 Human INT6 interacts with MCM7 and regulates its stability during S phase of the cell cycle. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Buchsbaum S., Morris C., Bochard V., Jalinot P. Cancer - Interactions investigated in the context of cancer A unique UniProtKB entry could not be associated with the p110 subunit of eIF3 or RFP since the exact gene product of the interactor cannot be ascertained. pjalinot@ens-lyon.fr A library of cDNAs prepared from human lymphocytes immortalized with EBV was used. Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation buchsbaum-2007-6 Human INT6 interacts with MCM7 and regulates its stability during S phase of the cell cycle. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Buchsbaum S., Morris C., Bochard V., Jalinot P. Cancer - Interactions investigated in the context of cancer A unique UniProtKB entry could not be associated with the p110 subunit of eIF3 or RFP since the exact gene product of the interactor cannot be ascertained. pjalinot@ens-lyon.fr A library of cDNAs prepared from human lymphocytes immortalized with EBV was used. Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation buchsbaum-2007-7 Human INT6 interacts with MCM7 and regulates its stability during S phase of the cell cycle. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Buchsbaum S., Morris C., Bochard V., Jalinot P. Cancer - Interactions investigated in the context of cancer A unique UniProtKB entry could not be associated with the p110 subunit of eIF3 or RFP since the exact gene product of the interactor cannot be ascertained. pjalinot@ens-lyon.fr A library of cDNAs prepared from human lymphocytes immortalized with EBV was used. Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation buchsbaum-2007-1 Human INT6 interacts with MCM7 and regulates its stability during S phase of the cell cycle. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Buchsbaum S., Morris C., Bochard V., Jalinot P. Cancer - Interactions investigated in the context of cancer A unique UniProtKB entry could not be associated with the p110 subunit of eIF3 or RFP since the exact gene product of the interactor cannot be ascertained. pjalinot@ens-lyon.fr A library of cDNAs prepared from human lymphocytes immortalized with EBV was used. Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation buchsbaum-2007-3 Human INT6 interacts with MCM7 and regulates its stability during S phase of the cell cycle. human-jurkat Homo sapiens jurkat Human T cell leukemia anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Buchsbaum S., Morris C., Bochard V., Jalinot P. Cancer - Interactions investigated in the context of cancer A unique UniProtKB entry could not be associated with the p110 subunit of eIF3 or RFP since the exact gene product of the interactor cannot be ascertained. pjalinot@ens-lyon.fr A library of cDNAs prepared from human lymphocytes immortalized with EBV was used. Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation mcm7_human DNA replication licensing factor MCM7 MCM7 CDC47 MCM2 CDC47 homolog P1.1-MCM3 protein protein human Homo sapiens Human MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVRSPQNQYPAELMRRFELYFQGPSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEAHRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPSQFEPLDMKLMRRYIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATYTSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVIFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV int6_human Integrator complex subunit 6 INTS6 DBI1 DDX26 DDX26A DBI-1 Protein deleted in cancer 1 Protein DDX26 protein protein human Homo sapiens Human MPILLFLIDTSASMNQRSHLGTTYLDTAKGAVETFMKLRARDPASRGDRYMLVTFEEPPYAIKAGWKENHATFMNELKNLQAEGLTTLGQSLRTAFDLLNLNRLVTGIDNYGQGRNPFFLEPAIIITITDGSKLTTTSGVQDELHLPLNSPLPGSELTKEPFRWDQRLFALVLRLPGTMSVESEQLTGVPLDDSAITPMCEVTGGRSYSVCSPRMLNQCLESLVQKVQSGVVINFEKAGPDPSPVEDGQPDISRPFGSQPWHSCHKLIYVRPNPKTGVPIGHWPVPESFWPDQNSPTLPPRTSHPVVKFSCTDCEPMVIDKLPFDKYELEPSPLTQFILERKSPQTCWQVYVSNSAKYSELGHPFGYLKASTALNCVNLFVMPYNYPVLLPLLDDLFKVHKAKPTLKWRQSFESYLKTMPPYYLGPLKKAVRMMGAPNLIADSMEYGLSYSVISYLKKLSQQAKIESDRVIGSVGKKVVQETGIKVRSRSHGLSMAYRKDFQQLLQGISEDVPHRLLDLNMKEYTGFQVALLNKDLKPQTFRNAYDIPRRNLLDHLTRMRSNLLKSTRRFLKGQDEDQVHSVPIAQMGNYQEYLKQVPSPLRELDPDQPRRLHTFGNPFKLDKKGMMIDEADEFVAGPQNKHKRPGEPNMQGIPKRRRCMSPLLRGRQQNPVVNNHIGGKGPPAPTTQAQPDLIKPLPLHKISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMKEIRKPGRKYERIFTLLKHVQGSLQTRLIFLQNVIKEASRFKKRMLIEQLENFLDEIHRRANQINHINSN ubb_human Polyubiquitin-B UBB protein protein human Homo sapiens Human MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC ints6-mcm7-1 FLAG-INT6 coimmunoprecipitated Myc-MCM7 in 293T lysates 661586 N/A 661593 unspecified role unspecified role prey prey n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 661594 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1 C Q9UL03; P33993 transfection MG132 (proteasome inhibitor) treatment enhances this interaction. ints6-mcm7-2 FLAG-INT6 coimmunoprecipitated with Myc-MCM7 in 293T lysates 661586 N/A 661593 unspecified role unspecified role bait bait n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 661594 unspecified role unspecified role prey prey c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1 C Q9UL03; P33993 transfection MG132 (proteasome inhibitor) treatment enhances this interaction. ints6-mcm7-4 Int6 coimmunoprecipitates MCM7 in HeLa lysates 661587 N/A 661594 unspecified role unspecified role bait bait N/A 661593 unspecified role unspecified role prey prey physical association physical association false false false 1 D mcm7-ints6-3 Int6 coimmunoprecipitates MCM7 in HeLa lysates 661587 N/A 661593 unspecified role unspecified role prey prey N/A 661594 unspecified role unspecified role bait bait physical association physical association false false false S1 B This interaction occurred in the nucleoplasmic faction and the chromatin fraction. MG132 treatment (proteasome inhibition) enhances this interaction. mcm7-ints6 MCM7 interacts with INT6 in a yeast two-hybrid assay 661588 N/A 661593 unspecified role unspecified role bait bait N/A 661594 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1 E ints6-mcm7-5 MCM7 interacts with INT6 in a yeast two-hybrid assay 661588 N/A 661593 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 661594 unspecified role unspecified role bait bait physical association physical association false false false 1B & 1F mcm7-ints6-1 GST-MCM7 (570-601) pulls down INT6 in vitro 661589 N/A 661593 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 661594 unspecified role unspecified role prey prey human-jurkat Homo sapiens jurkat Human T cell leukemia physical association physical association false false false 1 G mcm7-ints6-2 GST-MCM7 (570-601) pulls down His-INT6 in vitro 661589 N/A 661594 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 661593 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1 H mcm7-rps27a MCM7 is polyubiquitinated in 293T lysates 661590 N/A 661595 unspecified role unspecified role prey prey N/A 661593 unspecified role unspecified role bait bait physical association physical association false false false 2 A ints6-mcm7-6 HA-MCM7 is ubiqutinated in 293T lysates 661590 N/A 661595 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 661593 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2 C P33993; P62988 transfection ints6-mcm7 Int6 interacts with MCM7 in a yeast two-hybrid assay 661591 N/A 661593 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 661594 unspecified role unspecified role bait bait physical association physical association false false false 1 A ints6-mcm7-3 Int6 coimmunoprecipitates MCM7 in Jurkat lysates 661592 N/A 661594 unspecified role unspecified role bait bait N/A 661593 unspecified role unspecified role prey prey physical association physical association false false false 1 D