UniProt UniProt http://www.uniprot.org nakazawa-2007-3 Cooperative interaction between ETS1 and GFI1 transcription factors in the repression of Bax gene expression. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Nakazawa Y., Suzuki M., Manabe N., Yamada T., Kihara-Negishi F., Sakurai T., Tenen D.G., Iwama A., Mochizuki M., Oikawa T. Cancer - Interactions investigated in the context of cancer Interactions relating to HA-and FLAG-tagged ETS1 could not be added as the source of this protein was not given in the publication (fig. 1b and 1c). The species of these constructs has not been confirmed by the authors. oikawat@hoku-iryo-u.dc.jp Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation nakazawa-2007-1 Cooperative interaction between ETS1 and GFI1 transcription factors in the repression of Bax gene expression. mouse-el4 Mus musculus el4 Mouse ascites lymphoma lymphoblast line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Nakazawa Y., Suzuki M., Manabe N., Yamada T., Kihara-Negishi F., Sakurai T., Tenen D.G., Iwama A., Mochizuki M., Oikawa T. Cancer - Interactions investigated in the context of cancer Interactions relating to HA-and FLAG-tagged ETS1 could not be added as the source of this protein was not given in the publication (fig. 1b and 1c). The species of these constructs has not been confirmed by the authors. oikawat@hoku-iryo-u.dc.jp Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation gfi1_mouse Zinc finger protein Gfi-1 Gfi1 Gfi-1 Growth factor independent protein 1 protein protein mouse Mus musculus Mouse MPRSFLVKSKKAHSYHQPRSPGPDYSLRLETVPAPGRAEGGAVSAGESKMEPRERLSPDSQLTEAPDRASASPNSCEGSVCDPCSEFEDFWRPPSPSVSPASEKSLCRSLDEAQPYTLPFKPYAWSGLAGSDLRHLVQSYRQCSALERSAGLSLFCERGSEPGRPAARYGPEQAAGGAGAGQPGRCGVAGGATSAAGLGLYGDFAPAAAGLYERPSTAAGRLYQDHGHELHADKSVGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK ets1_human Protein C-ets-1 p54 ETS1 EWSR2 protein protein human Homo sapiens Human MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE ets1_mouse Protein C-ets-1 Ets1 Ets-1 p54 protein protein mouse Mus musculus Mouse MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMSGAALCALGKECFLELAPDFVGDILWEHLEILQKEDVKPYQVNGANPTYPESCYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILQDPLQTDTLQTDYFAIKQEVLTPDNMCLGRASRGKLGGQDSFESVESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDYEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDAD ets1-gfi1-1 1164751 n/a 1164753 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1164754 unspecified role unspecified role bait bait ets domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2b ets1-gfi1-2 1164751 n/a 1164753 unspecified role unspecified role prey prey zinc finger sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1164754 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2d gfi1-ets1 1164752 n/a 1164755 unspecified role unspecified role prey prey n/a 1164753 unspecified role unspecified role bait bait physical association physical association false false false 1a