IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fujii-2006-4 SNIP1 is a candidate modifier of the transcriptional activity of c-Myc on E box-dependent target genes. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fujii M., Lyakh LA., Bracken CP., Fukuoka J., Hayakawa M., Tsukiyama T., Soll SJ., Harris M., Rocha S., Roche KC., Tominaga S., Jen J., Perkins ND., Lechleider RJ., Roberts AB. Cancer - Interactions investigated in the context of cancer fujiim@jichi.ac.jp,lechleiderr@mail.nih.gov Human Hela cDNA library Mol. Cell (1097-2765) 2006 fujii-2006-6 SNIP1 is a candidate modifier of the transcriptional activity of c-Myc on E box-dependent target genes. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Fujii M., Lyakh LA., Bracken CP., Fukuoka J., Hayakawa M., Tsukiyama T., Soll SJ., Harris M., Rocha S., Roche KC., Tominaga S., Jen J., Perkins ND., Lechleider RJ., Roberts AB. Cancer - Interactions investigated in the context of cancer I searched for the CAD and cyclin B1 genes in human VEGA and used the sequences there to search for where the primers matched. Then I took the sequences determined from there as demarked by the primers and used NCBI nucleotide-nucleotide BLAST to find the accession number of the sequence containing the relevant sequence and this also showed the relevant ranges. fujiim@jichi.ac.jp,lechleiderr@mail.nih.gov Human Hela cDNA library Mol. Cell (1097-2765) 2006 fujii-2006-2 SNIP1 is a candidate modifier of the transcriptional activity of c-Myc on E box-dependent target genes. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Fujii M., Lyakh LA., Bracken CP., Fukuoka J., Hayakawa M., Tsukiyama T., Soll SJ., Harris M., Rocha S., Roche KC., Tominaga S., Jen J., Perkins ND., Lechleider RJ., Roberts AB. Cancer - Interactions investigated in the context of cancer fujiim@jichi.ac.jp,lechleiderr@mail.nih.gov Human Hela cDNA library Mol. Cell (1097-2765) 2006 fujii-2006-5 SNIP1 is a candidate modifier of the transcriptional activity of c-Myc on E box-dependent target genes. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Fujii M., Lyakh LA., Bracken CP., Fukuoka J., Hayakawa M., Tsukiyama T., Soll SJ., Harris M., Rocha S., Roche KC., Tominaga S., Jen J., Perkins ND., Lechleider RJ., Roberts AB. Cancer - Interactions investigated in the context of cancer fujiim@jichi.ac.jp,lechleiderr@mail.nih.gov Human Hela cDNA library Mol. Cell (1097-2765) 2006 fujii-2006-7 SNIP1 is a candidate modifier of the transcriptional activity of c-Myc on E box-dependent target genes. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fujii M., Lyakh LA., Bracken CP., Fukuoka J., Hayakawa M., Tsukiyama T., Soll SJ., Harris M., Rocha S., Roche KC., Tominaga S., Jen J., Perkins ND., Lechleider RJ., Roberts AB. Cancer - Interactions investigated in the context of cancer fujiim@jichi.ac.jp,lechleiderr@mail.nih.gov Human Hela cDNA library Mol. Cell (1097-2765) 2006 fujii-2006-1 SNIP1 is a candidate modifier of the transcriptional activity of c-Myc on E box-dependent target genes. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Fujii M., Lyakh LA., Bracken CP., Fukuoka J., Hayakawa M., Tsukiyama T., Soll SJ., Harris M., Rocha S., Roche KC., Tominaga S., Jen J., Perkins ND., Lechleider RJ., Roberts AB. Cancer - Interactions investigated in the context of cancer fujiim@jichi.ac.jp,lechleiderr@mail.nih.gov Human Hela cDNA library Mol. Cell (1097-2765) 2006 fujii-2006-3 SNIP1 is a candidate modifier of the transcriptional activity of c-Myc on E box-dependent target genes. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Fujii M., Lyakh LA., Bracken CP., Fukuoka J., Hayakawa M., Tsukiyama T., Soll SJ., Harris M., Rocha S., Roche KC., Tominaga S., Jen J., Perkins ND., Lechleider RJ., Roberts AB. Cancer - Interactions investigated in the context of cancer fujiim@jichi.ac.jp,lechleiderr@mail.nih.gov Human Hela cDNA library Mol. Cell (1097-2765) 2006 snip1_human Smad nuclear-interacting protein 1 SNIP1 FHA domain-containing protein SNIP1 protein protein human Homo sapiens Human MKAVKSERERGSRRRHRDGDVVLPAGVVVKQERLSPEVAPPAHRRPDHSGGSPSPPTSEPARSGHRGNRARGVSRSPPKKKNKASGRRSKSPRSKRNRSPHHSTVKVKQEREDHPRRGREDRQHREPSEQEHRRARNSDRDRHRGHSHQRRTSNERPGSGQGQGRDRDTQNLQAQEEEREFYNARRREHRQRNDVGGGGSESQELVPRPGGNNKEKEVPAKEKPSFELSGALLEDTNTFRGVVIKYSEPPEARIPKKRWRLYPFKNDEVLPVMYIHRQSAYLLGRHRRIADIPIDHPSCSKQHAVFQYRLVEYTRADGTVGRRVKPYIIDLGSGNGTFLNNKRIEPQRYYELKEKDVLKFGFSSREYVLLHESSDTSEIDRKDDEDEEEEEEVSDS myc_human Myc proto-oncogene protein BHLHE39 Transcription factor p64 MYC Proto-oncogene c-Myc Class E basic helix-loop-helix protein 39 protein protein human Homo sapiens Human MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA max_human Protein max MAX BHLHD4 Class D basic helix-loop-helix protein 4 Myc-associated factor X protein protein human Homo sapiens Human MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS pyr1_human_gene PYR1_HUMAN_GENE/CAD gene gene human Homo sapiens Human ccnb1_human_gene G2/mitotic-specific cyclin-B1 gene gene gene human Homo sapiens Human ep300_human Histone acetyltransferase p300 Histone butyryltransferase p300 Histone crotonyltransferase p300 Protein propionyltransferase p300 EP300 P300 E1A-associated protein p300 Protein 2-hydroxyisobutyryltransferase p300 Protein lactyltransferas p300 protein protein human Homo sapiens Human MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKAVPGGGMPNMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQPILTGAPVGLGNPSSLGVGQQSAPNLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQNPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSMAQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPSLPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQAIAEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELKTEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHLEPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGISPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPIPGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYPPQQQQRMQHHMQQMQQGNMGQIGQLPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH skp2_human S-phase kinase-associated protein 2 F-box protein Skp2 Cyclin-A/CDK2-associated protein p45 p45skp2 F-box/LRR-repeat protein 1 SKP2 FBXL1 protein protein human Homo sapiens Human MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL fbxw7_human F-box/WD repeat-containing protein 7 FBXW7 FBW7 FBX30 SEL10 F-box and WD-40 domain-containing protein 7 F-box protein FBX30 Archipelago homolog SEL-10 hCdc4 protein protein human Homo sapiens Human MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVVGVEPRPGGQNDSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQESDDFDQSDDSSREDEHTHTNSVTNSSSIVDLPVHQLSSPFYTKTTKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK snip1-myc-2 SNIP1 coimmunoprecipitates c-Myc in HEK293 cell lysate 588085 N/A 588092 unspecified role unspecified role bait bait N/A 588093 unspecified role unspecified role prey prey physical association physical association false false false 1 B myc-snip1-1 SNIP1 coimmunoprecipitates with c-Myc in HEK293 cell lysate 588085 N/A 588093 unspecified role unspecified role bait bait N/A 588092 unspecified role unspecified role prey prey physical association physical association false false false 1 B max-snip1 Max coimmunoprecipitates SNIP1 in HEK293 cell lysate 588085 N/A 588092 unspecified role unspecified role prey prey n/a 588094 unspecified role unspecified role bait bait physical association physical association false false false 1 C max-myc-4 Max coimmunoprecipitates c-Myc in HEK293 cell lysate 588085 N/A 588093 unspecified role unspecified role prey prey n/a 588094 unspecified role unspecified role bait bait physical association physical association false false false 1 C snip1-myc-4 SNIP1 coimmunoprecipitates c-Myc in HEK293 cell lysate 588085 N/A 588092 unspecified role unspecified role bait bait N/A 588093 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2 G P01106 transfected myc-nt_022184_14 Myc binds the E box-containing promoter region of the CAD gene 588086 n/a 588095 unspecified role unspecified role prey prey promoter_region CAD promoter E box domain sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 588093 unspecified role unspecified role bait bait association association false false false 3 G, 6D This suggests recruitment of SNIP1 and p300 to the Cad promoter is c-Myc dependent and that recruitment of p300 and SNIP1 is interdependent. It fits with cooperative regulation of c-Myc-dependent transcription by SNIP1 and p300. c-Myc siRNA greatly reduced this interaction. snip1-nt_022184_14-1 SNIP1 binds the E box-containing promoter region of the CAD gene 588086 N/A 588092 unspecified role unspecified role bait bait n/a 588095 unspecified role unspecified role prey prey promoter_region CAD promoter E box domain sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 3 G, 6 D c-Myc siRNA or p300 siRNA greatly reduced this interaction. This suggests recruitment of SNIP1 and p300 to the Cad promoter is c-Myc dependent and that recruitment of p300 and SNIP1 is interdependent. It fits with cooperative regulation of c-Myc-dependent transcription by SNIP1 and p300. snip1-nt_006713_14 SNIP1 binds the E box-containing promoter region of the cyclin B gene 588086 N/A 588092 unspecified role unspecified role bait bait n/a 588096 unspecified role unspecified role prey prey promoter_region cyclin B promoter E box domain sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 3 G c-Myc siRNA greatly reduced this interaction. myc-nt_006713_14-1 c-Myc binds the E box-containing promoter region of the cyclin B gene 588086 N/A 588093 unspecified role unspecified role bait bait n/a 588096 unspecified role unspecified role prey prey promoter_region cyclin B promoter E box domain sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 3 G c-Myc siRNA greatly reduced this interaction. ep300-nt_022184_14 p300 binds the E box-containing promoter region of the CAD gene 588086 n/a 588095 unspecified role unspecified role prey prey promoter_region CAD promoter E box domain sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 588097 unspecified role unspecified role bait bait association association false false false 6 D c-Myc siRNA or SNIP1 siRNA greatly reduced this interaction. This suggests recruitment of SNIP1 and p300 to the Cad promoter is c-Myc dependent and that recruitment of p300 and SNIP1 is interdependent. It fits with cooperative regulation of c-Myc-dependent transcription by SNIP1 and p300. myc-snip1 SNIP1 coimmunoprecipitates with c-Myc in HEK293 cell lysate 588087 N/A 588092 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 588093 unspecified role unspecified role bait bait physical association physical association false false false 1 A, 5 C, 6 A P01106; Q8TAD8 transfection P01106; Q8TAD8 overexpressed Binding of SNIP1 to c-Myc was abolished with Skp2 overexpression. The interaction of HA-SNIP1 with both endogenous c-Myc and ectopic c-Myc is enhanced by coexpression of Flag-p300. When the cells are not tranfected with a c-Myc expression vector HA-SNIP1 can interact with endogenous c-Myc. myc-skp2 SKP2 coimmunoprecipitates with c-Myc in HEK293 cell lysate 588087 N/A 588093 unspecified role unspecified role bait bait N/A 588098 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5 B P01106; Q13309 transfection P01106; Q13309 overexpressed Overexpression of SNIP1 reduced Skp2 bound to c-Myc. myc-fbxw7 FBW7 coimmunoprecipitates with c-Myc in HEK293 cell lysate 588087 N/A 588093 unspecified role unspecified role bait bait N/A 588099 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5 D P01106; Q969H0 transfection P01106; Q969H0 overexpressed Binding of Fbw7 to c-Myc was not affected by SNIP1 overexpression. myc-ep300 p300 coimmunoprecipitates with c-Myc in HEK293 cell lysate 588087 N/A 588093 unspecified role unspecified role bait bait N/A 588097 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 6 A P01106; Q09472 transfection P01106; Q09472 overexpressed The interaction of Flag-p300 with both endogenous c-Myc and ectopic c-Myc is enhanced by coexpression of HA-SNIP1. When the cells are not tranfected with a c-Myc expression vector Flag-p300 can interact with endogenous c-Myc. snip1-myc-3 GST-SNIP1 pulls down c-Myc 588088 N/A 588093 unspecified role unspecified role prey prey in vitro In vitro N/A 588092 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 2 A, B myc-snip1-2 GST-c-Myc pulls down SNIP1 588088 N/A 588093 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 588092 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 2 C myc-snip1-3 Endogenous SNIP1 complex formation with endogenous c-Myc varies with cell cycle progression 588089 N/A 588092 unspecified role unspecified role prey prey N/A 588093 unspecified role unspecified role bait bait physical association physical association false false false 5 F myc-skp2-1 Endogenous Skp2 complex formation with endogenous c-Myc varies with cell cycle progression 588089 N/A 588093 unspecified role unspecified role bait bait N/A 588098 unspecified role unspecified role prey prey physical association physical association false false false 5 F snip1-myc SNIP1 interacts with c-Myc in a yeast two-hybrid assay 588090 N/A 588092 unspecified role unspecified role bait bait N/A 588093 unspecified role unspecified role prey prey physical association physical association false false false snip1-myc-1 SNIP1 coimmunoprecipitates c-Myc in HEK293 cell lysate 588091 N/A 588093 unspecified role unspecified role prey prey N/A 588092 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1 A, 2D P01106; Q8TAD8 transfection P01106; Q8TAD8 overexpressed