IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wang-2006d-1 Epm2a suppresses tumor growth in an immunocompromised host by inhibiting Wnt signaling. mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Wang Y., Liu Y., Wu C., Zhang H., Zheng X., Zheng Z., Geiger TL., Nuovo GJ., Liu Y., Zheng P. Cancer - Interactions investigated in the context of cancer panz@umich.edu,yangl@umich.edu Cancer Cell (1535-6108) 2006 Only protein-protein interactions 2 imex curation wang-2006d-2 Epm2a suppresses tumor growth in an immunocompromised host by inhibiting Wnt signaling. mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang Y., Liu Y., Wu C., Zhang H., Zheng X., Zheng Z., Geiger TL., Nuovo GJ., Liu Y., Zheng P. Cancer - Interactions investigated in the context of cancer panz@umich.edu,yangl@umich.edu Cancer Cell (1535-6108) 2006 Only protein-protein interactions 2 imex curation wang-2006d-3 Epm2a suppresses tumor growth in an immunocompromised host by inhibiting Wnt signaling. in vitro In vitro phosphatase assay phosphatase assay antibody detection identification by antibody antibody detection Wang Y., Liu Y., Wu C., Zhang H., Zheng X., Zheng Z., Geiger TL., Nuovo GJ., Liu Y., Zheng P. Cancer - Interactions investigated in the context of cancer panz@umich.edu,yangl@umich.edu Cancer Cell (1535-6108) 2006 Only protein-protein interactions 2 imex curation epm2a_mouse Laforin Epm2a Lafora PTPase Glucan phosphatase protein protein mouse Mus musculus Mouse MLFRFGVVVPPAVAGARQELLLAGSRPELGRWEPHGAVRLRPAGTAAGAAALALQEPGLWLAEVELEAYEEAGGAEPGRVDTFWYKFLQREPGGELHWEGNGPHHDRCCTYNEDNLVDGVYCLPVGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQLEHVTIKLKHELGVTAVMNFQTEWDIIQNSSGCNRYPEPMTPDTMMKLYKEEGLSYIWMPTPDMSTEGRVQMLPQAVCLLHALLENGHTVYVHCNAGVGRSTAAVCGWLHYVIGWNLRKVQYFIMAKRPAVYIDEDALAQAQQDFSQKFGKVHSSICAL gsk3b_mouse Glycogen synthase kinase-3 beta Gsk3b Serine/threonine-protein kinase GSK3B protein protein mouse Mus musculus Mouse MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST gsk3b-hu-bsa_protein Fusion of a modified peptide representing human GSK-3beta to bovine serum albumin (BSA) peptide peptide polypeptide oligopeptide oligopeptide polypeptide human Homo sapiens Human CGPKGPGRRGRRRTSSFAEG An amino acid sequence which is not represented in UniProt Residue 15 (serine) is phosphorylated. The protein reference given by the authors for the human GSK-3beta (NP_002084) has an insertion of 13 residues between residues 303 and 304 of the Uniprotkb sequence (P49841). gsk3b-epm2a 515350 N/A 515353 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 515354 unspecified role unspecified role bait bait physical association physical association false false false 7 E, S3 The mutation in laforin (cys265ser) did not affect binding, indicating the association does not require laforin phosphatase activity. The association was not affected by PDGF. gsk3b-epm2a-1 515351 N/A 515353 unspecified role unspecified role prey prey N/A 515354 unspecified role unspecified role bait bait physical association physical association false false false 7 E epm2a-gsk3b 515352 N/A 515355 enzyme target enzyme target substrate substrate unspecified role unspecified role ser-15 the peptide representing human GSK3-beta is phopshorylated on Ser15 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 515353 enzyme enzyme unspecified role unspecified role region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9WUA5:p.Cys265Ser mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. dephosphorylation dephosphorylation reaction dephosphorylation false false false 7 F The peptide representing human GSK-3beta (with modifications) fused to BSA, is dephosphorylated on ser15. The authors state that this residue corresponds to GSK-3beta Ser9. This dephosphorylation was detected using antibodies specific for phosphorylated GSK-3beta Ser9. The laforin did not dephosphorylate Bad.