IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ namkoong-2006-2 The bone morphogenetic protein antagonist gremlin 1 is overexpressed in human cancers and interacts with YWHAH protein. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Namkoong H., Shin SM., Kim HK., Ha SA., Cho GW., Hur SY., Kim TE., Kim JW. Synapse - Interactions of proteins with an established role in the presynapse. Figure 5 (A) Figure 5 (B) nkhong1@hanmail.net Human fetal brain cDNA library BMC Cancer 2006 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer namkoong-2006-3 The bone morphogenetic protein antagonist gremlin 1 is overexpressed in human cancers and interacts with YWHAH protein. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Namkoong H., Shin SM., Kim HK., Ha SA., Cho GW., Hur SY., Kim TE., Kim JW. Synapse - Interactions of proteins with an established role in the presynapse. Figure 4(A) Figure 4(B) nkhong1@hanmail.net Human fetal brain cDNA library BMC Cancer 2006 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer namkoong-2006-1 The bone morphogenetic protein antagonist gremlin 1 is overexpressed in human cancers and interacts with YWHAH protein. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Namkoong H., Shin SM., Kim HK., Ha SA., Cho GW., Hur SY., Kim TE., Kim JW. Synapse - Interactions of proteins with an established role in the presynapse. nkhong1@hanmail.net Human fetal brain cDNA library BMC Cancer 2006 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer 1433f_human 14-3-3 protein eta YWHAH YWHA1 Protein AS1 protein protein human Homo sapiens Human MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN grem1_human Gremlin-1 GREM1 CKTSF1B1 DAND2 DRM PIG2 Cysteine knot superfamily 1, BMP antagonist 1 Increased in high glucose protein 2 Down-regulated in Mos-transformed cells protein DAN domain family member 2 Cell proliferation-inducing gene 2 protein protein protein human Homo sapiens Human MSRTAYTVGALLLLLGTLLPAAEGKKKGSQGAIPPPDKAQHNDSEQTQSPQQPGSRNRGRGQGRGTAMPGEEVLESSQEALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYGQCNSFYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD grem1-14_3_3 eta-1 Pulldown analysis reveals interaction between the Gremlin 1 protein and YWHAH protein 362454 N/A 362457 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) N/A 362458 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 14_3_3 eta-grem1 Pulldown analysis reveals interaction between the YWHAH protein and Gremlin 1 protein 362454 N/A 362457 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 362458 unspecified role unspecified role prey prey direct interaction direct interaction false false false grem1-14_3_3 eta-2 Coimmunoprecipitation analysis reveals interaction between the Gremlin 1 protein and YWHAH protein 362455 N/A 362457 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 362458 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 14_3_3 eta-grem1-1 Coimmunoprecipitation analysis reveals interaction between the YWHAH protein and Gremlin 1 protein 362455 N/A 362457 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 362458 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false grem1-14_3_3 eta Yeast 2 hybrid analysis reveals interaction between the Gremlin 1 protein and YWHAH protein 362456 N/A 362457 unspecified role unspecified role prey prey N/A 362458 unspecified role unspecified role bait bait physical association physical association false false false