IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ baldassarre-2005-1 p27(Kip1)-stathmin interaction influences sarcoma cell migration and invasion. human-ht1080 Homo sapiens HT1080 fribrosarcoma cell line ht1080 confirmed as human with IEF of AST, LDH, NP established from the biopsy from a fibrosarcoma of a 35-year-old Caucasian man in 1972 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Baldassarre G., Belletti B., Nicoloso MS., Schiappacassi M., Vecchione A., Spessotto P., Morrione A., Canzonieri V., Colombatti A. Cancer - Interactions investigated in the context of cancer gbaldassarre@cro.it Cancer Cell (1535-6108) 2005 baldassarre-2005-2 p27(Kip1)-stathmin interaction influences sarcoma cell migration and invasion. mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Baldassarre G., Belletti B., Nicoloso MS., Schiappacassi M., Vecchione A., Spessotto P., Morrione A., Canzonieri V., Colombatti A. Cancer - Interactions investigated in the context of cancer Mouse fetal brain (day 18 p.c.) was used gbaldassarre@cro.it Cancer Cell (1535-6108) 2005 baldassarre-2005-3 p27(Kip1)-stathmin interaction influences sarcoma cell migration and invasion. pig-brain Sus scrofa pig brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Baldassarre G., Belletti B., Nicoloso MS., Schiappacassi M., Vecchione A., Spessotto P., Morrione A., Canzonieri V., Colombatti A. Cancer - Interactions investigated in the context of cancer Adult pig brain was used. gbaldassarre@cro.it Cancer Cell (1535-6108) 2005 baldassarre-2005-4 p27(Kip1)-stathmin interaction influences sarcoma cell migration and invasion. mouse-fibroblast Mus musculus fibroblast Fibroblast Resident cell of connective tissue, mesodermally derived anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Baldassarre G., Belletti B., Nicoloso MS., Schiappacassi M., Vecchione A., Spessotto P., Morrione A., Canzonieri V., Colombatti A. Cancer - Interactions investigated in the context of cancer The mouse fibroblasts were adherent to FN. gbaldassarre@cro.it Cancer Cell (1535-6108) 2005 stmn1_human Stathmin Phosphoprotein p19 Leukemia-associated phosphoprotein p18 Oncoprotein 18 pp17 Prosolin Metablastin Protein Pr22 STMN1 LAP18 OP18 C1orf215 protein protein human Homo sapiens Human MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD cdn1b_human Cyclin-dependent kinase inhibitor 1B Cyclin-dependent kinase inhibitor p27 p27Kip1 CDKN1B KIP1 protein protein human Homo sapiens Human MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT cdn1b_mouse Cyclin-dependent kinase inhibitor 1B Cyclin-dependent kinase inhibitor p27 p27Kip1 Cdkn1b protein protein mouse Mus musculus Mouse MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGRYEWQEVERGSLPEFYYRPPRPPKSACKVLAQESQDVSGSRQAVPLIGSQANSEDRHLVDQMPDSSDNPAGLAEQCPGMRKRPAAEDSSSQNKRANRTEENVSDGSPNAGTVEQTPKKPGLRRQT stmn1_mouse Stathmin Phosphoprotein p19 Leukemia-associated phosphoprotein p18 Oncoprotein 18 pp17 Prosolin Metablastin Protein Pr22 Leukemia-associated gene protein Stmn1 Lag Lap18 Pr22 protein protein mouse Mus musculus Mouse MASSDIQVKELEKRASGQAFELILSPRSKESVPDFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHVEEVRKNKESKDPADETEAD q9bdc3_pig Cyclin-dependent kinase inhibitor 1B CDKN1B p27Kip1 Cyclin-dependent kinase inhibitor p27 protein protein pig Sus scrofa (Pig) Pig MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQEGQGVSGTRQAVPLIGSQANSEDTHLVDQKTDAPDSQTGLAEQCTGIRKRPATDDSSPQNKRANRTEENVSDGSPNSASVEQTPKKPGLRRRQT stmn1_pig Stathmin STMN1 protein protein pig Sus scrofa (Pig) Pig MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD stmn1-cdkn1b 509492 N/A 509496 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 509497 unspecified role unspecified role prey prey c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region EGFP tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false The protein (AAA20240) coded for by the p27 sequence they refer to (U10906) has a Ser at position 175 whereas the Uniprot sequence has a Leu. 3 A cdkn1b-stmn1 509493 N/A 509498 unspecified role unspecified role bait bait N/A 509499 unspecified role unspecified role prey prey physical association physical association false false false 3 B Stathmin is a ubiquitous protein expressed at highest levels in brain, which peaks in the neonatal period and decreases in adult life. p27kip1-stmn1 509494 N/A 509500 unspecified role unspecified role bait bait N/A 509501 unspecified role unspecified role prey prey direct interaction direct interaction false false false S4 A cdkn1b-stmn1-1 509495 N/A 509499 unspecified role unspecified role prey prey N/A 509498 unspecified role unspecified role bait bait physical association physical association false false false S4 B This interaction occurred in mouse fibroblasts adherent to fibronectin. This interaction did not occur in serum-starved mouse fibroblasts.