IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ knappstein-2004-2 Alpha 1-antitrypsin binds to and interferes with functionality of EspB from atypical and typical enteropathogenic Escherichia coli strains. in vitro In vitro pull down pull down edman degradation edman degradation Knappstein S., Ide T., Schmidt MA., Heusipp G. Cancer - Interactions investigated in the context of cancer infekt@uni-muenster.de Infect. Immun. (0019-9567) 2004 Only protein-protein interactions imex curation knappstein-2004-1 Alpha 1-antitrypsin binds to and interferes with functionality of EspB from atypical and typical enteropathogenic Escherichia coli strains. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Knappstein S., Ide T., Schmidt MA., Heusipp G. Cancer - Interactions investigated in the context of cancer infekt@uni-muenster.de Infect. Immun. (0019-9567) 2004 Only protein-protein interactions imex curation p71213_ecolx espB EKI52_12965 C6N50_004400 CCV24_001216 CX694_003167 CYM75_002980 F9V22_21585 G4A38_02845 GFZ60_21045 A8X14_001698 AAG80_002511 ABE90_023190 B6R12_005072 B6R15_003131 BMC34_002600 ERS085386_04437 ERS085411_04537 BJJ90_23555 NCTC8960_02077 DIV22_19905 E2119_26280 GGB84_001983 GF199_10240 protein protein ecolx Escherichia coli MNTIDYTNQVMTVNSVSENTTGSNAITASAINSSLLTDGKVDVSKLMLEIQKLLGKMVRILQDYQQQQLSQSYQIQLAVFESQNKAIDEKKAAATAALVGGAISSVLGILGSFAAINSATKGASDIAQKTASTSSKAIDAASDTATKTLTKATESVADAVEDASSVMQQAMTTATRAASRTSDVADDIADSAQRASQLAENAADAAQKASRASRFMAAVDKITGSTPFIAVTSLAEGTKTLPTTVSESVKSNHEISEQRYKSVENFQQGNLDLYKQEVRRAQDDIASRLRDMTTAARDLTDLQNRMGQSVRLAG a1at_human Alpha-1-antitrypsin Alpha-1 protease inhibitor Alpha-1-antiproteinase AAT PI PRO0684 PRO2209 SERPINA1 Serpin A1 protein protein human Homo sapiens Human MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK espb-aat EspB interacts with AAT as shown in a pull down experiment 891664 n/a 891666 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecobb Escherichia coli (strain B / BL21) n/a 891667 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1 espb-aat-2 EspB interacts with AAT as shown in a pull down experiment 891664 n/a 891667 unspecified role unspecified role prey prey human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma n/a 891666 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false Fig. 1 espb-aat-1 EspB interacts with AAT as shown in a pull down experiment 891665 n/a 891667 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 n/a 891666 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false Fig. 1