IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ko-2004-2 Human LZIP binds to CCR1 and differentially affects the chemotactic activities of CCR1-dependent chemokines. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ko J., Jang SW., Kim YS., Kim IS., Sung HJ., Kim HH., Park JY., Lee YH., Kim J., Na DS. Cancer - Interactions investigated in the context of cancer Mammalian two-hybrid was used with the CAT reporter system. CAT activity was detected by scintillation counting and TLC. 2 jesangko@amc.seoul.kr Human Hela cDNA FASEB J. (0892-6638) 2004 Only protein-protein interactions imex curation ko-2004-1 Human LZIP binds to CCR1 and differentially affects the chemotactic activities of CCR1-dependent chemokines. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Ko J., Jang SW., Kim YS., Kim IS., Sung HJ., Kim HH., Park JY., Lee YH., Kim J., Na DS. Cancer - Interactions investigated in the context of cancer Mammalian two-hybrid was used with the CAT reporter system. CAT activity was detected by scintillation counting and TLC. 2 jesangko@amc.seoul.kr Human Hela cDNA FASEB J. (0892-6638) 2004 Only protein-protein interactions imex curation ko-2004-3 Human LZIP binds to CCR1 and differentially affects the chemotactic activities of CCR1-dependent chemokines. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ko J., Jang SW., Kim YS., Kim IS., Sung HJ., Kim HH., Park JY., Lee YH., Kim J., Na DS. Cancer - Interactions investigated in the context of cancer Mammalian two-hybrid was used with the CAT reporter system. CAT activity was detected by scintillation counting and TLC. 2 jesangko@amc.seoul.kr Human Hela cDNA FASEB J. (0892-6638) 2004 Only protein-protein interactions imex curation ko-2004-4 Human LZIP binds to CCR1 and differentially affects the chemotactic activities of CCR1-dependent chemokines. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ko J., Jang SW., Kim YS., Kim IS., Sung HJ., Kim HH., Park JY., Lee YH., Kim J., Na DS. Cancer - Interactions investigated in the context of cancer Mammalian two-hybrid was used with the CAT reporter system. CAT activity was detected by scintillation counting and TLC. 2 jesangko@amc.seoul.kr Human Hela cDNA FASEB J. (0892-6638) 2004 Only protein-protein interactions imex curation ko-2004-5 Human LZIP binds to CCR1 and differentially affects the chemotactic activities of CCR1-dependent chemokines. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ko J., Jang SW., Kim YS., Kim IS., Sung HJ., Kim HH., Park JY., Lee YH., Kim J., Na DS. Cancer - Interactions investigated in the context of cancer Mammalian two-hybrid was used with the CAT reporter system. CAT activity was detected by scintillation counting and TLC. 2 jesangko@amc.seoul.kr Human Hela cDNA FASEB J. (0892-6638) 2004 Only protein-protein interactions imex curation ko-2004-6 Human LZIP binds to CCR1 and differentially affects the chemotactic activities of CCR1-dependent chemokines. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Ko J., Jang SW., Kim YS., Kim IS., Sung HJ., Kim HH., Park JY., Lee YH., Kim J., Na DS. Cancer - Interactions investigated in the context of cancer Mammalian two-hybrid was used with the CAT reporter system. CAT activity was detected by scintillation counting and TLC. 2 jesangko@amc.seoul.kr Human Hela cDNA FASEB J. (0892-6638) 2004 Only protein-protein interactions imex curation ko-2004-7 Human LZIP binds to CCR1 and differentially affects the chemotactic activities of CCR1-dependent chemokines. human-periph_blood_leukoc Homo sapiens peripheral blood leukocytes peripheral_blood_leukocyte Peripheral blood leukocytes [Peripheral blood leucocytes] fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Ko J., Jang SW., Kim YS., Kim IS., Sung HJ., Kim HH., Park JY., Lee YH., Kim J., Na DS. Cancer - Interactions investigated in the context of cancer Mammalian two-hybrid was used with the CAT reporter system. CAT activity was detected by scintillation counting and TLC. 2 jesangko@amc.seoul.kr Human Hela cDNA FASEB J. (0892-6638) 2004 Only protein-protein interactions imex curation o43889-2 Cyclic AMP-responsive element-binding protein 3 CREB3 LZIP Luman Transcription factor LZIP-alpha LZIP Leucine zipper protein protein protein human Homo sapiens Human MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG ccr1_human C-C chemokine receptor type 1 Macrophage inflammatory protein 1-alpha receptor RANTES-R HM145 LD78 receptor CCR1 CMKBR1 CMKR1 SCYAR1 protein protein human Homo sapiens Human METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLREWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF ccr5_human C-C chemokine receptor type 5 HIV-1 fusion coreceptor CHEMR13 CCR5 CMKBR5 protein protein human Homo sapiens Human MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL ccr1-lzip-4 Interaction between human CCR1 and LZIP detected by beta galactosidase 361705 N/A 361712 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 361713 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false ccr5-lzip-1 Interaction between human CCR1 and LZIP detected by beta galactosidase 361705 N/A 361712 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 361714 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false ccr1-lzip-3 Interaction between human CCR1 and LZIP detected by Y2H 361706 N/A 361712 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 361713 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false ccr1-lzip-9 Interaction between human CCR1 and LZIP detected by mammalian two-hybrid 361707 N/A 361712 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 361713 unspecified role unspecified role bait bait physical association physical association false false false ccr1-lzip-12 Interaction between human CCR1 and LZIP detected by coIP 361708 N/A 361712 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 361713 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false ccr1-lzip-15 Interaction between human CCR1 and LZIP detected by coIP 361709 N/A 361712 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 361713 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false ccr1-lzip-16 Colocalization of CCR1 and LZIP detected by confocal microscopy 361710 N/A 361712 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 361713 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false ccr1-lzip-17 Colocalization of CCR1 and LZIP detected by confocal microscopy 361711 N/A 361712 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 361713 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false