IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ cui-2003b-1 Using yeast two-hybrid system to identify ECRG2 associated proteins and their possible interactions with ECRG2 gene. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cui YP., Wang JB., Zhang XY., Bi MX., Guo LP., Lu SH. Cancer - Interactions investigated in the context of cancer A unique UniProtKB entry could not be associated with ferritin and hemoglobin. shlu@public.bta.net.cn A human fetal liver cDNA library was used. World J. Gastroenterol. (1007-9327) 2003 cui-2003b-2 Using yeast two-hybrid system to identify ECRG2 associated proteins and their possible interactions with ECRG2 gene. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cui YP., Wang JB., Zhang XY., Bi MX., Guo LP., Lu SH. Cancer - Interactions investigated in the context of cancer A unique UniProtKB entry could not be associated with ferritin and hemoglobin. shlu@public.bta.net.cn A human fetal liver cDNA library was used. World J. Gastroenterol. (1007-9327) 2003 mt2_human Metallothionein-2 Metallothionein-II Metallothionein-2A MT2A CES1 MT2 protein protein human Homo sapiens Human MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA isk7_human Serine protease inhibitor Kazal-type 7 Esophagus cancer-related gene 2 protein SPINK7 ECG2 UNQ745/PRO1474 protein protein human Homo sapiens Human MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC mt1h_human Metallothionein-1H MT1H Metallothionein-IH Metallothionein-0 protein protein human Homo sapiens Human MDPNCSCEAGGSCACAGSCKCKKCKCTSCKKSCCSCCPLGCAKCAQGCICKGASEKCSCCA mt1g_human Metallothionein-1G Metallothionein-IG Metallothionein-1K MT1G MT1K MT1M protein protein human Homo sapiens Human MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCCA epb42_human Protein 4.2 EPB42 E42P Erythrocyte membrane protein band 4.2 protein protein human Homo sapiens Human MGQALGIKSCDFQAARNNEEHHTKALSSRRLFVRRGQPFTIILYFRAPVRAFLPALKKVALTAQTGEQPSKINRTQATFPISSLGDRKWWSAVVEERDAQSWTISVTTPADAVIGHYSLLLQVSGRKQLLLGQFTLLFNPWNREDAVFLKNEAQRMEYLLNQNGLIYLGTADCIQAESWDFGQFEGDVIDLSLRLLSKDKQVEKWSQPVHVARVLGALLHFLKEQRVLPTPQTQATQEGALLNKRRGSVPILRQWLTGRGRPVYDGQAWVLAAVACTVLRCLGIPARVVTTFASAQGTGGRLLIDEYYNEEGLQNGEGQRGRIWIFQTSTECWMTRPALPQGYDGWQILHPSAPNGGGVLGSCDLVPVRAVKEGTLGLTPAVSDLFAAINASCVVWKCCEDGTLELTDSNTKYVGNNISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPPSLETASPLYLLLKAPSSLPLRGDAQISVTLVNHSEQEKAVQLAIGVQAVHYNGVLAAKLWRKKLHLTLSANLEKIITIGLFFSNFERNPPENTFLRLTAMATHSESNLSCFAQEDIAICRPHLAIKMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVTVVAPELSA rt12_human 28S ribosomal protein S12, mitochondrial MT-RPS12 MRPS12 RPMS12 RPSM12 Mitochondrial small ribosomal subunit protein uS12m protein protein human Homo sapiens Human MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK q8izw4_human protein protein human Homo sapiens Human RRARCWHKAPERQRQGLKPGFSWAGADAQSGVGSCHLGNCWDLQSQRCHLHSMVLILPASWPEGHPDHKSGGLSVCLHLPQRCLLSFPTHSSLFGVRGGTGQLAQDLLIIAAQVFE rabl6_human Rab-like protein 6 RABL6 C9orf86 GTP-binding protein Parf PARF Partner of ARF Rab-like protein 1 protein protein human Homo sapiens Human MFSALKKLVGSDQAPGRDKNIPAGLQSMNQALQRRFAKGVQYNMKIVIRGDRNTGKTALWHRLQGRPFVEEYIPTQEIQVTSIHWSYKTTDDIVKVEVWDVVDKGKCKKRGDGLKMENDPQEAESEMALDAEFLDVYKNCNGVVMMFDITKQWTFNYILRELPKVPTHVPVCVLGNYRDMGEHRVILPDDVRDFIDNLDRPPGSSYFRYAESSMKNSFGLKYLHKFFNIPFLQLQRETLLRQLETNQLDMDATLEELSVQQETEDQNYGIFLEMMEARSRGHASPLAANGQSPSPGSQSPVVPAGAVSTGSSSPGTPQPAPQLPLNAAPPSSVPPVPPSEALPPPACPSAPAPRRSIISRLFGTSPATEAAPPPPEPVPAAEGPATVQSVEDFVPDDRLDRSFLEDTTPARDEKKVGAKAAQQDSDSDGEALGGNPMVAGFQDDVDLEDQPRGSPPLPAGPVPSQDITLSSEEEAEVAAPTKGPAPAPQQCSEPETKWSSIPASKPRRGTAPTRTAAPPWPGGVSVRTGPEKRSSTRPPAEMEPGKGEQASSSESDPEGPIAAQMLSFVMDDPDFESEGSDTQRRADDFPVRDDPSDVTDEDEGPAEPPPPPKLPLPAFRLKNDSDLFGLGLEEAGPKESSEEGKEGKTPSKEKKKKKKKGKEEEEKAAKKKSKHKKSKDKEEGKEERRRRQQRPPRSRERTAADELEAFLGGGAPGGRHPGGGDYEEL spink7-mt2a-4 ECRG2 (SPINK7) interacts with MT2A in a yeast two-hybrid assay 652771 N/A 652773 unspecified role unspecified role prey prey N/A 652774 unspecified role unspecified role bait bait physical association physical association false false false 2, Table 1 BAIT gene AF268198 spink7-mt1h-1 ECRG2 (SPINK7) interacts with MT1H in a yeast two-hybrid assay 652771 N/A 652775 unspecified role unspecified role prey prey N/A 652774 unspecified role unspecified role bait bait physical association physical association false false false 2, Table 1 BAIT gene AF268198 spink7-mt1g-1 ECRG2 (SPINK7) interacts with MT1G in a yeast two-hybrid assay 652771 N/A 652776 unspecified role unspecified role prey prey N/A 652774 unspecified role unspecified role bait bait physical association physical association false false false 2, Table 1 BAIT gene AF268198 spink7-epb42 ECRG2 (SPINK7) interacts with EBP42 in a yeast two-hybrid assay 652771 N/A 652774 unspecified role unspecified role bait bait N/A 652777 unspecified role unspecified role prey prey physical association physical association false false false 2, Table 1 BAIT gene AF268198 spink7-mrps12-1 ECRG2 (SPINK7) interacts with MRPS12 in a yeast two-hybrid assay 652771 N/A 652778 unspecified role unspecified role prey prey N/A 652774 unspecified role unspecified role bait bait physical association physical association false false false 2, Table 1 BAIT gene AF268198 spink7-q8izw4-1 ECRG2 (SPINK7) interacts with AF422192 in a yeast two-hybrid assay 652771 N/A 652779 unspecified role unspecified role prey prey N/A 652774 unspecified role unspecified role bait bait physical association physical association false false false 2, Table 1 BAIT gene AF268198; PREY gene AF422192 spink7-parf-1 ECRG2 (SPINK7) interacts with FLJ10101 in a yeast two-hybrid assay 652771 N/A 652780 unspecified role unspecified role prey prey N/A 652774 unspecified role unspecified role bait bait physical association physical association false false false 2, Table 1 BAIT gene AF268198 spink7-mt1h-2 ECRG2 (SPINK7) interacts with MT1H in a yeast two-hybrid assay 652772 N/A 652774 unspecified role unspecified role bait bait N/A 652775 unspecified role unspecified role prey prey physical association physical association false false false BAIT gene AF268198 spink7-mt2a-5 ECRG2 (SPINK7) interacts with MT2A in a yeast two-hybrid assay 652772 N/A 652773 unspecified role unspecified role prey prey N/A 652774 unspecified role unspecified role bait bait physical association physical association false false false BAIT gene AF268198 spink7-mt1g-2 ECRG2 (SPINK7) interacts with MT1G in a yeast two-hybrid assay 652772 N/A 652774 unspecified role unspecified role bait bait N/A 652776 unspecified role unspecified role prey prey physical association physical association false false false BAIT gene AF268198 spink7-epb42-1 ECRG2 (SPINK7) interacts with EBP42 in a yeast two-hybrid assay 652772 N/A 652774 unspecified role unspecified role bait bait N/A 652777 unspecified role unspecified role prey prey physical association physical association false false false BAIT gene AF268198 spink7-mrps12-2 ECRG2 (SPINK7) interacts with MRPS12 in a yeast two-hybrid assay 652772 N/A 652774 unspecified role unspecified role bait bait N/A 652778 unspecified role unspecified role prey prey physical association physical association false false false BAIT gene AF268198 spink7-q8izw4-2 ECRG2 (SPINK7) interacts with AF422192 in a yeast two-hybrid assay 652772 N/A 652774 unspecified role unspecified role bait bait N/A 652779 unspecified role unspecified role prey prey physical association physical association false false false BAIT gene AF268198; PREY gene AF422192 spink7-parf-2 ECRG2 (SPINK7) interacts with FLJ10101 in a yeast two-hybrid assay 652772 N/A 652780 unspecified role unspecified role prey prey N/A 652774 unspecified role unspecified role bait bait physical association physical association false false false BAIT gene AF268198