IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ emberley-2002-1 RanBPM interacts with psoriasin in vitro and their expression correlates with specific clinical features in vivo in breast cancer. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Emberley ED., Gietz RD., Campbell JD., HayGlass KT., Murphy LC., Watson PH. Cancer - Interactions investigated in the context of cancer umember0@cc.umanitoba.ca A normal human mammary gland cDNA Prey library (Clontech) was used. BMC Cancer 2002 emberley-2002-2 RanBPM interacts with psoriasin in vitro and their expression correlates with specific clinical features in vivo in breast cancer. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Emberley ED., Gietz RD., Campbell JD., HayGlass KT., Murphy LC., Watson PH. Cancer - Interactions investigated in the context of cancer umember0@cc.umanitoba.ca A normal human mammary gland cDNA Prey library (Clontech) was used. BMC Cancer 2002 emberley-2002-3 RanBPM interacts with psoriasin in vitro and their expression correlates with specific clinical features in vivo in breast cancer. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Emberley ED., Gietz RD., Campbell JD., HayGlass KT., Murphy LC., Watson PH. Cancer - Interactions investigated in the context of cancer umember0@cc.umanitoba.ca A normal human mammary gland cDNA Prey library (Clontech) was used. BMC Cancer 2002 s10a7_human Protein S100-A7 S100A7 PSOR1 S100A7C S100 calcium-binding protein A7 Psoriasin protein protein human Homo sapiens Human MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ ranb9_human Ran-binding protein 9 RanBP7 Ran-binding protein M BPM90 BPM-L RANBP9 RANBPM protein protein human Homo sapiens Human MSGQPPPPPPQQQQQQQQLSPPPPAALAPVSGVVLPAPPAVSAGSSPAGSPGGGAGGEGLGAAAAALLLHPPPPPPPATAAPPPPPPPPPPPASAAAPASGPPAPPGLAAGPGPAGGAPTPALVAGSSAAAPFPHGDSALNEQEKELQRRLKRLYPAVDEQETPLPRSWSPKDKFSYIGLSQNNLRVHYKGHGKTPKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINNTCFYTKNGHSLGIAFTDLPPNLYPTVGLQTPGEVVDANFGQHPFVFDIEDYMREWRTKIQAQIDRFPIGDREGEWQTMIQKMVSSYLVHHGYCATAEAFARSTDQTVLEELASIKNRQRIQKLVLAGRMGEAIETTQQLYPSLLERNPNLLFTLKVRQFIEMVNGTDSEVRCLGGRSPKSQDSYPVSPRPFSSPSMSPSHGMNIHNLASGKGSTAHFSGFESCSNGVISNKAHQSYCHSNKHQSSNLNVPELNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTEMEVDSSQLRRQLCGGSQAAIERMIHFGRELQAMSEQLRRDCGKNTANKKMLKDAFSLLAYSDPWNSPVGNQLDPIQREPVCSALNSAILETHNLPKQPPLALAMGQATQCLGLMARSGIGSCAFATVEDYLH s100a7-ranbp9 566704 N/A 566707 unspecified role unspecified role bait bait N/A 566708 unspecified role unspecified role prey prey physical association physical association false false false s100a7-ranbp9-1 566705 N/A 566708 unspecified role unspecified role prey prey N/A 566707 unspecified role unspecified role bait bait physical association physical association false false false 1 s100a7-ranbp9-2 566706 N/A 566708 unspecified role unspecified role bait bait n-terminal His-Xpress epitope tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region 35S-methionine labeled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 566707 unspecified role unspecified role prey prey region 35S-methionine labeled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 2