IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lauffart-2002-1 Interaction of the transforming acidic coiled-coil 1 (TACC1) protein with ch-TOG and GAS41/NuBI1 suggests multiple TACC1-containing protein complexes in human cells. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lauffart B., Howell SJ., Tasch JE., Cowell JK., Still IH. Cancer - Interactions investigated in the context of cancer Full-length GAS41 fused to GFP was expressed in stably transfected cells and indirect immunofluoresence with the TACC1 antibody and a rhodamine-labelled secondary antibody was used. Brenda.Laufert@roswellpark.org A human mammary epithelial cDNA library from ClonTech Laboratories (Palo Alto, CA, U.S.A.) was used. Biochem. J. (0264-6021) 2002 lauffart-2002-2 Interaction of the transforming acidic coiled-coil 1 (TACC1) protein with ch-TOG and GAS41/NuBI1 suggests multiple TACC1-containing protein complexes in human cells. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lauffart B., Howell SJ., Tasch JE., Cowell JK., Still IH. Cancer - Interactions investigated in the context of cancer Full-length GAS41 fused to GFP was expressed in stably transfected cells and indirect immunofluoresence with the TACC1 antibody and a rhodamine-labelled secondary antibody was used. Brenda.Laufert@roswellpark.org A human mammary epithelial cDNA library from ClonTech Laboratories (Palo Alto, CA, U.S.A.) was used. Biochem. J. (0264-6021) 2002 lauffart-2002-3 Interaction of the transforming acidic coiled-coil 1 (TACC1) protein with ch-TOG and GAS41/NuBI1 suggests multiple TACC1-containing protein complexes in human cells. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lauffart B., Howell SJ., Tasch JE., Cowell JK., Still IH. Cancer - Interactions investigated in the context of cancer Full-length GAS41 fused to GFP was expressed in stably transfected cells and indirect immunofluoresence with the TACC1 antibody and a rhodamine-labelled secondary antibody was used. Brenda.Laufert@roswellpark.org A human mammary epithelial cDNA library from ClonTech Laboratories (Palo Alto, CA, U.S.A.) was used. Biochem. J. (0264-6021) 2002 lauffart-2002-4 Interaction of the transforming acidic coiled-coil 1 (TACC1) protein with ch-TOG and GAS41/NuBI1 suggests multiple TACC1-containing protein complexes in human cells. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Lauffart B., Howell SJ., Tasch JE., Cowell JK., Still IH. Cancer - Interactions investigated in the context of cancer Full-length GAS41 fused to GFP was expressed in stably transfected cells and indirect immunofluoresence with the TACC1 antibody and a rhodamine-labelled secondary antibody was used. Brenda.Laufert@roswellpark.org A human mammary epithelial cDNA library from ClonTech Laboratories (Palo Alto, CA, U.S.A.) was used. Biochem. J. (0264-6021) 2002 lauffart-2002-5 Interaction of the transforming acidic coiled-coil 1 (TACC1) protein with ch-TOG and GAS41/NuBI1 suggests multiple TACC1-containing protein complexes in human cells. human-mda_mb_468 Homo sapiens MDA-MB-468 mda_mb_468 MDA-MB-468 breast adenocarcinoma Species: human, Black; Tissue: breast; Tumor: adenocarcinoma; Derived from: pleural effusion fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Lauffart B., Howell SJ., Tasch JE., Cowell JK., Still IH. Cancer - Interactions investigated in the context of cancer Full-length GAS41 fused to GFP was expressed in stably transfected cells and indirect immunofluoresence with the TACC1 antibody and a rhodamine-labelled secondary antibody was used. Brenda.Laufert@roswellpark.org A human mammary epithelial cDNA library from ClonTech Laboratories (Palo Alto, CA, U.S.A.) was used. Biochem. J. (0264-6021) 2002 ckap5_human Cytoskeleton-associated protein 5 CKAP5 KIAA0097 Colonic and hepatic tumor overexpressed gene protein protein protein human Homo sapiens Human MGDDSEWLKLPVDQKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAVRDEAKLIAVEIYRWIRDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQIDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFIARSFRHCTASTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKAVNPFLADVDKLKLDKIKECSEKVELIHGKKAGLAADKKEFKPLPGRTAASGAAGDKDTKDISAPKPGPLKKAPAAKAGGPPKKGKPAAPGGAGNTGTKNKKGLETKEIVEPELSIEVCEEKASAVLPPTCIQLLDSSNWKERLACMEEFQKAVELMDRTEMPCQALVRMLAKKPGWKETNFQVMQMKLHIVALIAQKGNFSKTSAQVVLDGLVDKIGDVKCGNNAKEAMTAIAEACMLPWTAEQVVSMAFSQKNPKNQSETLNWLSNAIKEFGFSGLNVKAFISNVKTALAATNPAVRTAAITLLGVMYLYVGPSLRMFFEDEKPALLSQIDAEFEKMQGQSPPAPTRGISKHSTSGTDEGEDGDEPDDGSNDVVDLLPRTEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINDAKFIQPNIGELPTALKGRLNDSNKILVQQTLNILQQLAVAMGPNIKQHVKNLGIPIITVLGDSKNNVRAAALATVNAWAEQTGMKEWLEGEDLSEELKKENPFLRQELLGWLAEKLPTLRSTPTDLILCVPHLYSCLEDRNGDVRKKAQDALPFFMMHLGYEKMAKATGKLKPTSKDQVLAMLEKAKVNMPAKPAPPTKATSKPMGGSAPAKFQPASAPAEDCISSSTEPKPDPKKAKAPGLSSKAKSAQGKKMPSKTSLKEDEDKSGPIFIVVPNGKEQRMKDEKGLKVLKWNFTTPRDEYIEQLKTQMSSCVAKWLQDEMFHSDFQHHNKALAVMVDHLESEKEGVIGCLDLILKWLTLRFFDTNTSVLMKALEYLKLLFTLLSEEEYHLTENEASSFIPYLVVKVGEPKDVIRKDVRAILNRMCLVYPASKMFPFIMEGTKSKNSKQRAECLEELGCLVESYGMNVCQPTPGKALKEIAVHIGDRDNAVRNAALNTIVTVYNVHGDQVFKLIGNLSEKDMSMLEERIKRSAKRPSAAPIKQVEEKPQRAQNISSNANMLRKGPAEDMSSKLNQARSMSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEPKIRAVSPHFDDMHSNTASTINFIISQVASGDINTSIQALTQIDEVLRQEDKAEAMSGHIDQFLIATFMQLRLIYNTHMADEKLEKDEIIKLYSCIIGNMISLFQIESLAREASTGVLKDLMHGLITLMLDSRIEDLEEGQQVIRSVNLLVVKVLEKSDQTNILSALLVLLQDSLLATASSPKFSELVMKCLWRMVRLLPDTINSINLDRILLDIHIFMKVFPKEKLKQCKSEFPIRTLKTLLHTLCKLKGPKILDHLTMIDNKNESELEAHLCRMMKHSMDQTGSKSDKETEKGASRIDEKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKYSDADIEPFLKNSSQFFQSYVERGLRVIEMEREGKGRISTSTGISPQMEVTCVPTPTSTVSSIGNTNGEEVGPSVYLERLKILRQRCGLDNTKQDDRPPLTSLLSKPAVPTVASSTDMLHSKLSQLRESREQHQHSDLDSNQTHSSGTVTSSSSTANIDDLKKRLERIKSSRK tacc1_human Transforming acidic coiled-coil-containing protein 1 Taxin-1 Gastric cancer antigen Ga55 TACC1 KIAA1103 protein protein human Homo sapiens Human MAFSPWQILSPVQWAKWTWSAVRGGAAGEDEAGGPEGDPEEEDSQAETKSLSFSSDSEGNFETPEAETPIRSPFKESCDPSLGLAGPGAKSQESQEADEQLVAEVVEKCSSKTCSKPSENEVPQQAIDSHSVKNFREEPEHDFSKISIVRPFSIETKDSTDISAVLGTKAAHGCVTAVSGKALPSSPPDALQDEAMTEGSMGVTLEASAEADLKAGNSCPELVPSRRSKLRKPKPVPLRKKAIGGEFSDTNAAVEGTPLPKASYHFSPEELDENTSPLLGDARFQKSPPDLKETPGTLSSDTNDSGVELGEESRSSPLKLEFDFTEDTGNIEARKALPRKLGRKLGSTLTPKIQKDGISKSAGLEQPTDPVARDGPLSQTSSKPDPSQWESPSFNPFGSHSVLQNSPPLSSEGSYHFDPDNFDESMDPFKPTTTLTSSDFCSPTGNHVNEILESPKKAKSRLITSGCKVKKHETQSLALDACSRDEGAVISQISDISNRDGHATDEEKLASTSCGQKSAGAEVKGEPEEDLEYFECSNVPVSTINHAFSSSEAGIEKETCQKMEEDGSTVLGLLESSAEKAPVSVSCGGESPLDGICLSESDKTAVLTLIREEIITKEIEANEWKKKYEETRQEVLEMRKIVAEYEKTIAQMIEDEQRTSMTSQKSFQQLTMEKEQALADLNSVERSLSDLFRRYENLKGVLEGFKKNEEALKKCAQDYLARVKQEEQRYQALKIHAEEKLDKANEEIAQVRTKAKAESAALHAGLRKEQMKVESLERALQQKNQEIEELTKICDELIAKLGKTD yets4_human YEATS domain-containing protein 4 YEATS4 Glioma-amplified sequence 41 NuMA-binding protein 1 GAS41 protein protein human Homo sapiens Human MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI tacc1-ckap5 566240 N/A 566245 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind range range range range false N/A 566246 unspecified role unspecified role bait bait physical association physical association false false false 1 A The authors state TACC1 interacted with the protein corresponding to the C-terminal 529 amino acids of ch-TOG and that this starts at residue 1443. However, this would make the protein 1972 residues in length whereas the UniprotKB entry is 2032 aa in length. The ch-TOG interactor has a feature describing the C-terminal 529 amino acids (which does contain the KXGS motif described) but starts at residue 1704. The sequence comparison of SDP repeats in Figure 2 has slightly different residue positions for TACC1 than the UniprotKb entry for TACC1. tacc1-yeats4 566240 N/A 566247 unspecified role unspecified role prey prey c-terminal TACIP 38 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 566246 unspecified role unspecified role bait bait physical association physical association false false false 1 B The sequence comparison of SDP repeats in Figure 2 has slightly different residue positions for TACC1 than the UniprotKb entry for TACC1. tacc1-yeats4-1 566241 N/A 566247 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 566246 unspecified role unspecified role bait bait physical association physical association false false false 1 B The sequence comparison of SDP repeats in Figure 2 has slightly different residue positions for TACC1 than the UniprotKb entry for TACC1. tacc1-yeats4-2 566241 N/A 566246 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 566247 unspecified role unspecified role prey prey c-terminal TACIP 38 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2 A The sequence comparison of SDP repeats in Figure 2 has slightly different residue positions for TACC1 than the UniprotKb entry for TACC1. yeats4-tacc1 566242 N/A 566246 unspecified role unspecified role prey prey N/A 566247 unspecified role unspecified role bait bait c-terminus GFP tag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 3 The sequence comparison of SDP repeats in Figure 2 has slightly different residue positions for TACC1 than the UniprotKb entry for TACC1. tacc1-yeats4-3 566243 N/A 566247 unspecified role unspecified role neutral component neutral component c-terminus GFP tag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 566246 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4 This experiment suggests that the primary site of interaction between GAS41 and TACC1 is the nuceus. The sequence comparison of SDP repeats in Figure 2 has slightly different residue positions for TACC1 than the UniprotKb entry for TACC1. tacc1-yeats4-4 566244 N/A 566247 unspecified role unspecified role neutral component neutral component c-terminus GFP tag fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 566246 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4 This experiment suggests that the primary site of interaction between GAS41 and TACC1 is the nuceus. The sequence comparison of SDP repeats in Figure 2 has slightly different residue positions for TACC1 than the UniprotKb entry for TACC1.